BLASTX nr result
ID: Alisma22_contig00043534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043534 (235 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ60341.1 UDP-Xyl: xylogalacturonan beta-1,3-xylosyltransferase... 125 5e-32 JAT47943.1 putative glycosyltransferase At5g03795, partial [Anth... 121 2e-30 XP_008805667.1 PREDICTED: probable glycosyltransferase At3g07620... 120 4e-30 XP_010254014.1 PREDICTED: probable glycosyltransferase At3g07620... 120 5e-30 XP_008242549.1 PREDICTED: probable glycosyltransferase At3g07620... 119 1e-29 XP_008337502.1 PREDICTED: probable glycosyltransferase At3g07620... 119 2e-29 OAY27251.1 hypothetical protein MANES_16G111200 [Manihot esculenta] 118 2e-29 KJB06657.1 hypothetical protein B456_001G007900 [Gossypium raimo... 117 3e-29 XP_019192583.1 PREDICTED: probable glycosyltransferase At3g07620... 118 3e-29 XP_019192580.1 PREDICTED: probable glycosyltransferase At3g07620... 118 3e-29 OAY27250.1 hypothetical protein MANES_16G111200 [Manihot esculenta] 118 3e-29 XP_007204617.1 hypothetical protein PRUPE_ppa002387mg [Prunus pe... 117 4e-29 XP_011048342.1 PREDICTED: probable glycosyltransferase At3g07620... 117 4e-29 ONH98015.1 hypothetical protein PRUPE_7G223400 [Prunus persica] 117 4e-29 ONH98014.1 hypothetical protein PRUPE_7G223400 [Prunus persica] 117 4e-29 XP_019084215.1 PREDICTED: probable glycosyltransferase At5g03795... 111 4e-29 XP_016440900.1 PREDICTED: probable glycosyltransferase At3g07620... 117 5e-29 XP_009782188.1 PREDICTED: probable glycosyltransferase At5g03795... 117 5e-29 XP_009352527.1 PREDICTED: probable glycosyltransferase At3g07620... 117 6e-29 XP_016440892.1 PREDICTED: probable glycosyltransferase At3g07620... 117 6e-29 >KMZ60341.1 UDP-Xyl: xylogalacturonan beta-1,3-xylosyltransferase, family GT47 [Zostera marina] Length = 531 Score = 125 bits (313), Expect = 5e-32 Identities = 58/71 (81%), Positives = 66/71 (92%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYETK+TMERSIRALCNADL+ FR+GKDVSLPETYVR G++P RD+GGKPA++R ILA Sbjct: 310 APYETKHTMERSIRALCNADLAEGFRVGKDVSLPETYVRSGRNPQRDIGGKPANERPILA 369 Query: 200 FYAGNMHGYLR 232 FYAGNMHGYLR Sbjct: 370 FYAGNMHGYLR 380 >JAT47943.1 putative glycosyltransferase At5g03795, partial [Anthurium amnicola] Length = 577 Score = 121 bits (303), Expect = 2e-30 Identities = 55/72 (76%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++TMERSIR+LCNADL + F+LGKDVSLPETYVR +DP +DLGGKP++ R IL Sbjct: 464 APYETRHTMERSIRSLCNADLGNGFKLGKDVSLPETYVRAARDPQKDLGGKPSNDRPILC 523 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 524 FYAGNMHGYLRP 535 >XP_008805667.1 PREDICTED: probable glycosyltransferase At3g07620 [Phoenix dactylifera] XP_008805745.1 PREDICTED: probable glycosyltransferase At3g07620 [Phoenix dactylifera] XP_017696908.1 PREDICTED: probable glycosyltransferase At3g07620 [Phoenix dactylifera] Length = 711 Score = 120 bits (302), Expect = 4e-30 Identities = 57/72 (79%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET+++MERSIRALCNADL FRLGKDVSLPETYVR ++PLRDLGGKPA QR ILA Sbjct: 490 APYETRHSMERSIRALCNADLREGFRLGKDVSLPETYVRSARNPLRDLGGKPADQRPILA 549 Query: 200 FYAGNMHGYLRP 235 F+AGN+HG LRP Sbjct: 550 FFAGNLHGRLRP 561 >XP_010254014.1 PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera] XP_010254016.1 PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera] XP_010254017.1 PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera] Length = 668 Score = 120 bits (301), Expect = 5e-30 Identities = 53/72 (73%), Positives = 66/72 (91%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ MER I+ALCNAD++ F++G+DVSLPETYVRF ++PLRD+GGKP S+RTILA Sbjct: 448 APYETRHHMERCIKALCNADVAGGFKIGRDVSLPETYVRFARNPLRDVGGKPPSERTILA 507 Query: 200 FYAGNMHGYLRP 235 F+AGNMHGYLRP Sbjct: 508 FFAGNMHGYLRP 519 >XP_008242549.1 PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume] Length = 678 Score = 119 bits (298), Expect = 1e-29 Identities = 54/72 (75%), Positives = 65/72 (90%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ MER ++ALCNAD++S F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 457 APYETRHHMERCMKALCNADVTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRQILA 516 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 517 FYAGNMHGYLRP 528 >XP_008337502.1 PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica] Length = 661 Score = 119 bits (297), Expect = 2e-29 Identities = 55/72 (76%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNADL+S F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 440 APYETRHHMELCIKALCNADLTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQREILA 499 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 500 FYAGNMHGYLRP 511 >OAY27251.1 hypothetical protein MANES_16G111200 [Manihot esculenta] Length = 526 Score = 118 bits (295), Expect = 2e-29 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD++S F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 305 APYETRHHMEHCIKALCNADVTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA 364 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 365 FYAGNMHGYLRP 376 >KJB06657.1 hypothetical protein B456_001G007900 [Gossypium raimondii] Length = 450 Score = 117 bits (292), Expect = 3e-29 Identities = 53/72 (73%), Positives = 65/72 (90%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETYVR ++PLRDLGGKPASQR ILA Sbjct: 229 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPASQRHILA 288 Query: 200 FYAGNMHGYLRP 235 FYAG+MHGYLRP Sbjct: 289 FYAGSMHGYLRP 300 >XP_019192583.1 PREDICTED: probable glycosyltransferase At3g07620 isoform X2 [Ipomoea nil] Length = 645 Score = 118 bits (295), Expect = 3e-29 Identities = 53/72 (73%), Positives = 65/72 (90%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETY+R ++PLRDLGGKPASQR ILA Sbjct: 424 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYIRSQRNPLRDLGGKPASQRRILA 483 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 484 FYAGNMHGYLRP 495 >XP_019192580.1 PREDICTED: probable glycosyltransferase At3g07620 isoform X1 [Ipomoea nil] XP_019192581.1 PREDICTED: probable glycosyltransferase At3g07620 isoform X1 [Ipomoea nil] XP_019192582.1 PREDICTED: probable glycosyltransferase At3g07620 isoform X1 [Ipomoea nil] Length = 674 Score = 118 bits (295), Expect = 3e-29 Identities = 53/72 (73%), Positives = 65/72 (90%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETY+R ++PLRDLGGKPASQR ILA Sbjct: 453 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYIRSQRNPLRDLGGKPASQRRILA 512 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 513 FYAGNMHGYLRP 524 >OAY27250.1 hypothetical protein MANES_16G111200 [Manihot esculenta] Length = 698 Score = 118 bits (295), Expect = 3e-29 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD++S F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 477 APYETRHHMEHCIKALCNADVTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA 536 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 537 FYAGNMHGYLRP 548 >XP_007204617.1 hypothetical protein PRUPE_ppa002387mg [Prunus persica] ONH98016.1 hypothetical protein PRUPE_7G223400 [Prunus persica] ONH98017.1 hypothetical protein PRUPE_7G223400 [Prunus persica] Length = 678 Score = 117 bits (294), Expect = 4e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ MER ++ALCNAD++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 457 APYETRHHMERCMKALCNADVTGGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRQILA 516 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 517 FYAGNMHGYLRP 528 >XP_011048342.1 PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica] XP_011048344.1 PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica] XP_011048345.1 PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica] Length = 682 Score = 117 bits (294), Expect = 4e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 461 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRNILA 520 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 521 FYAGNMHGYLRP 532 >ONH98015.1 hypothetical protein PRUPE_7G223400 [Prunus persica] Length = 698 Score = 117 bits (294), Expect = 4e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ MER ++ALCNAD++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 477 APYETRHHMERCMKALCNADVTGGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRQILA 536 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 537 FYAGNMHGYLRP 548 >ONH98014.1 hypothetical protein PRUPE_7G223400 [Prunus persica] Length = 708 Score = 117 bits (294), Expect = 4e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ MER ++ALCNAD++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 487 APYETRHHMERCMKALCNADVTGGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRQILA 546 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 547 FYAGNMHGYLRP 558 >XP_019084215.1 PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa] Length = 211 Score = 111 bits (278), Expect = 4e-29 Identities = 50/71 (70%), Positives = 62/71 (87%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+D+SLPETYVR K+PLRDLGGKP SQR LA Sbjct: 113 APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA 172 Query: 200 FYAGNMHGYLR 232 FYAG+MHGYLR Sbjct: 173 FYAGSMHGYLR 183 >XP_016440900.1 PREDICTED: probable glycosyltransferase At3g07620 isoform X2 [Nicotiana tabacum] Length = 637 Score = 117 bits (293), Expect = 5e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 416 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKILA 475 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 476 FYAGNMHGYLRP 487 >XP_009782188.1 PREDICTED: probable glycosyltransferase At5g03795 isoform X2 [Nicotiana sylvestris] Length = 637 Score = 117 bits (293), Expect = 5e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 416 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKILA 475 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 476 FYAGNMHGYLRP 487 >XP_009352527.1 PREDICTED: probable glycosyltransferase At3g07620 [Pyrus x bretschneideri] Length = 661 Score = 117 bits (293), Expect = 6e-29 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNADL+S F++G+DVSLPETYVR ++PLRDLGGKP S+R ILA Sbjct: 440 APYETRHHMELCIKALCNADLTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSRREILA 499 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 500 FYAGNMHGYLRP 511 >XP_016440892.1 PREDICTED: probable glycosyltransferase At3g07620 isoform X1 [Nicotiana tabacum] Length = 692 Score = 117 bits (293), Expect = 6e-29 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +2 Query: 20 APYETKNTMERSIRALCNADLSSEFRLGKDVSLPETYVRFGKDPLRDLGGKPASQRTILA 199 APYET++ ME I+ALCNAD+++ F++G+DVSLPETYVR ++PLRDLGGKP SQR ILA Sbjct: 471 APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKILA 530 Query: 200 FYAGNMHGYLRP 235 FYAGNMHGYLRP Sbjct: 531 FYAGNMHGYLRP 542