BLASTX nr result
ID: Alisma22_contig00043425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043425 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDO98227.1 unnamed protein product [Coffea canephora] 59 7e-08 >CDO98227.1 unnamed protein product [Coffea canephora] Length = 318 Score = 58.5 bits (140), Expect = 7e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 115 MEYSSLIDTSLDLNVKPMRILDDGVLKQEVQSNFI 11 MEY+SL+DTSLDLN+KP+R+LDDG LKQEVQSN I Sbjct: 1 MEYTSLVDTSLDLNIKPLRLLDDG-LKQEVQSNLI 34