BLASTX nr result
ID: Alisma22_contig00043383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043383 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006840145.1 PREDICTED: myb family transcription factor APL [A... 54 1e-06 >XP_006840145.1 PREDICTED: myb family transcription factor APL [Amborella trichopoda] ERN01820.1 hypothetical protein AMTR_s00089p00057120 [Amborella trichopoda] Length = 291 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -1 Query: 129 LSREEMQGPPEGTNSLSADADAAYCLVLTTDSKPRLRWTAQLH 1 L RE++QG EGTN L DA CLVLTTD KPRLRWTA+LH Sbjct: 12 LGREDLQGALEGTN-LPGDA----CLVLTTDPKPRLRWTAELH 49