BLASTX nr result
ID: Alisma22_contig00043376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043376 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT52380.1 hypothetical protein g.10387 [Anthurium amnicola] 56 3e-07 >JAT52380.1 hypothetical protein g.10387 [Anthurium amnicola] Length = 270 Score = 56.2 bits (134), Expect = 3e-07 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 5/94 (5%) Frame = -3 Query: 296 KNLEGSSASKAKNSLAPXXXXTVAAPIREDLPQLNYMVNQAAHHAILSQ-----PIHPQA 132 K E S KN + P PQ++YM N H+++ P + + Sbjct: 143 KEAEKSGCEVVKN-INPNCTAATLPTTITSFPQVSYMAN----HSMVQDSGNVAPPYARV 197 Query: 131 YYPTESYMVPMTYHMQGSCLAPVPPCCMREHCYY 30 YY E Y +P TY+ + AP PPCC+ +HCYY Sbjct: 198 YYAMEPYPIPATYYTSNAYAAPPPPCCIGDHCYY 231