BLASTX nr result
ID: Alisma22_contig00043164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043164 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV87838.1 RVT_2 domain-containing protein, partial [Cephalotus ... 68 4e-11 CAN78328.1 hypothetical protein VITISV_034971 [Vitis vinifera] 66 2e-10 CAN64613.1 hypothetical protein VITISV_030850 [Vitis vinifera] 65 5e-10 KZV23775.1 Cysteine-rich RLK (receptor-like protein kinase) 8 [D... 64 5e-10 KZV42540.1 hypothetical protein F511_37689 [Dorcoceras hygrometr... 61 7e-10 KZV33423.1 Cysteine-rich RLK (receptor-like protein kinase) 8 [D... 64 9e-10 CAN77322.1 hypothetical protein VITISV_002172 [Vitis vinifera] 64 1e-09 CAN83363.1 hypothetical protein VITISV_015902 [Vitis vinifera] 64 2e-09 CAN64040.1 hypothetical protein VITISV_034789 [Vitis vinifera] 64 2e-09 CAN61245.1 hypothetical protein VITISV_007013 [Vitis vinifera] 64 2e-09 CAN72986.1 hypothetical protein VITISV_005624 [Vitis vinifera] 64 2e-09 GAV82313.1 Stress-antifung domain-containing protein/RVT_2 domai... 64 2e-09 CAN67064.1 hypothetical protein VITISV_017541 [Vitis vinifera] 64 2e-09 CAN72141.1 hypothetical protein VITISV_017108 [Vitis vinifera] 64 2e-09 CAN61499.1 hypothetical protein VITISV_040265 [Vitis vinifera] 63 2e-09 CAN62654.1 hypothetical protein VITISV_033270 [Vitis vinifera] 63 2e-09 XP_008381699.1 PREDICTED: uncharacterized protein LOC103444531 [... 62 3e-09 AFP55546.1 gag-pol polyprotein [Rosa rugosa] 63 3e-09 EOY20844.1 Uncharacterized protein TCM_012183 [Theobroma cacao] 62 5e-09 XP_010094679.1 E3 ubiquitin-protein ligase listerin [Morus notab... 62 5e-09 >GAV87838.1 RVT_2 domain-containing protein, partial [Cephalotus follicularis] Length = 555 Score = 68.2 bits (165), Expect = 4e-11 Identities = 29/49 (59%), Positives = 42/49 (85%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKE 156 +GVDY++ FSP++ LNSV ++ +VV+ DWPLFQLD+K+AFLYGD+ +E Sbjct: 125 YGVDYFETFSPVARLNSVRLIISLVVNFDWPLFQLDIKNAFLYGDLSEE 173 >CAN78328.1 hypothetical protein VITISV_034971 [Vitis vinifera] Length = 374 Score = 65.9 bits (159), Expect = 2e-10 Identities = 27/52 (51%), Positives = 43/52 (82%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +GVDY + F+P++ LN+V VL+ + V+ DWPL+QLDVK+AFL G +++E++M Sbjct: 97 YGVDYQETFAPVAKLNTVQVLHSIAVNNDWPLYQLDVKNAFLNGGLNEEVYM 148 >CAN64613.1 hypothetical protein VITISV_030850 [Vitis vinifera] Length = 598 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 HG+DY + FSP++ L +V VL + + DWPL QLDVK+AFL+GD+ +EI+M Sbjct: 196 HGIDYQETFSPVAKLKTVRVLLSLAANLDWPLHQLDVKNAFLHGDLEEEIYM 247 >KZV23775.1 Cysteine-rich RLK (receptor-like protein kinase) 8 [Dorcoceras hygrometricum] Length = 206 Score = 63.5 bits (153), Expect = 5e-10 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ LN+V +L + + DWPL+Q+DVK+AFL GD+ +E+FM Sbjct: 54 YGIDYQETFAPVAKLNTVRILLSLAANLDWPLYQMDVKNAFLNGDLQEEVFM 105 >KZV42540.1 hypothetical protein F511_37689 [Dorcoceras hygrometricum] Length = 101 Score = 60.8 bits (146), Expect = 7e-10 Identities = 24/52 (46%), Positives = 39/52 (75%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ LN++ +L + +WPL QLDVK+AFL G++ KE+FM Sbjct: 42 YGIDYQETFAPVAKLNTIRILLSTAANLEWPLHQLDVKNAFLQGELEKEVFM 93 >KZV33423.1 Cysteine-rich RLK (receptor-like protein kinase) 8 [Dorcoceras hygrometricum] Length = 570 Score = 64.3 bits (155), Expect = 9e-10 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 + +DY + F+P++ LN+V +L Y+ + DWPL+Q+DVK+AFL GD+ +E+FM Sbjct: 133 YDIDYQETFAPVAKLNTVRILLYLAANLDWPLYQMDVKNAFLNGDLQEEVFM 184 >CAN77322.1 hypothetical protein VITISV_002172 [Vitis vinifera] Length = 776 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 HG+DY + FSP++ L +V VL + + DWPL Q+D+K+AFL+GD+ +EI+M Sbjct: 391 HGIDYQETFSPVAKLKTVRVLLSLAANLDWPLHQIDIKNAFLHGDLEEEIYM 442 >CAN83363.1 hypothetical protein VITISV_015902 [Vitis vinifera] Length = 371 Score = 63.5 bits (153), Expect = 2e-09 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ LN++ VL Y+ + DWPL QLDVK+AFL G++ +E++M Sbjct: 37 YGIDYRETFAPVAKLNTIQVLFYLAANQDWPLHQLDVKNAFLNGNLEEEVYM 88 >CAN64040.1 hypothetical protein VITISV_034789 [Vitis vinifera] Length = 621 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 HG+DY + FSP++ LN+V VL + DWPL QLDVK+AFL+G++ +E++M Sbjct: 278 HGIDYSETFSPVAKLNTVRVLLSLAAKLDWPLHQLDVKNAFLHGNLDEEVYM 329 >CAN61245.1 hypothetical protein VITISV_007013 [Vitis vinifera] Length = 632 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ +NS+ VL + V+ +WPL QLDVK+AFL GD+ +E+FM Sbjct: 256 YGIDYQETFAPVAKINSIRVLLSLAVNSNWPLHQLDVKNAFLNGDLEEEVFM 307 >CAN72986.1 hypothetical protein VITISV_005624 [Vitis vinifera] Length = 761 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ +NS+ VL + V+ +WPL QLDVK+AFL GD+ +E+FM Sbjct: 418 YGIDYQETFTPVAKINSIRVLLSLAVNSNWPLHQLDVKNAFLNGDLEEEVFM 469 >GAV82313.1 Stress-antifung domain-containing protein/RVT_2 domain-containing protein, partial [Cephalotus follicularis] Length = 790 Score = 63.5 bits (153), Expect = 2e-09 Identities = 25/52 (48%), Positives = 42/52 (80%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 + +DY + F+P++ +N+V VL V V+ DWPLFQ+DVK+AFL+G++ +E++M Sbjct: 108 YSIDYNETFAPVAKMNTVRVLMSVAVNLDWPLFQMDVKNAFLHGELEEEVYM 159 >CAN67064.1 hypothetical protein VITISV_017541 [Vitis vinifera] Length = 1127 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ +NS+ VL + V+ +WPL QLDVK+AFL GD+ +E+FM Sbjct: 621 YGIDYQETFAPVAKINSIRVLLSLAVNSNWPLHQLDVKNAFLNGDLEEEVFM 672 >CAN72141.1 hypothetical protein VITISV_017108 [Vitis vinifera] Length = 1416 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ +NS+ VL + V+ +WPL QLDVK+AFL GD+ +E+FM Sbjct: 978 YGIDYQETFAPVAKINSIRVLLSLTVNSNWPLHQLDVKNAFLNGDLEEEVFM 1029 >CAN61499.1 hypothetical protein VITISV_040265 [Vitis vinifera] Length = 913 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/50 (56%), Positives = 40/50 (80%) Frame = +1 Query: 16 VDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 VDY + FS ++ LN+V VL ++VV+ DWPL Q DVK+AFL+GD+ +EI+M Sbjct: 498 VDYMETFSSVAKLNTVRVLLFLVVNLDWPLLQFDVKNAFLHGDLEEEIYM 547 >CAN62654.1 hypothetical protein VITISV_033270 [Vitis vinifera] Length = 963 Score = 63.2 bits (152), Expect = 2e-09 Identities = 26/52 (50%), Positives = 42/52 (80%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+PI+ +NS+ VL +VV+ +WPL QLDVK++FL GD+ +E+F+ Sbjct: 527 YGIDYQETFAPIAKINSIRVLLSLVVNSNWPLHQLDVKNSFLNGDLEEEVFL 578 >XP_008381699.1 PREDICTED: uncharacterized protein LOC103444531 [Malus domestica] XP_008384237.1 PREDICTED: uncharacterized protein LOC103446860 [Malus domestica] Length = 264 Score = 62.4 bits (150), Expect = 3e-09 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = +1 Query: 13 GVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 GVDY + F P++ +NSV VL V V+ WPL+Q+DVK+ FL+GD+ +E+FM Sbjct: 43 GVDYKETFVPVAKMNSVRVLLSVAVNCGWPLYQMDVKNVFLHGDLQEEVFM 93 >AFP55546.1 gag-pol polyprotein [Rosa rugosa] Length = 1180 Score = 62.8 bits (151), Expect = 3e-09 Identities = 25/52 (48%), Positives = 41/52 (78%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +GVDY + F+P++ +N++ VL + + DWPL Q DVK+AFL+GD+H+E++M Sbjct: 743 YGVDYDETFAPVAKINTIRVLLSLAANLDWPLQQFDVKNAFLHGDLHEEVYM 794 >EOY20844.1 Uncharacterized protein TCM_012183 [Theobroma cacao] Length = 305 Score = 62.0 bits (149), Expect = 5e-09 Identities = 23/52 (44%), Positives = 39/52 (75%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +GVDY + F+P++ +N +C+ ++ V+ DWPL Q DVK+AFL D+ +E++M Sbjct: 58 YGVDYQETFAPVAKINIICIFIFIAVNRDWPLQQFDVKNAFLSRDLEEEVYM 109 >XP_010094679.1 E3 ubiquitin-protein ligase listerin [Morus notabilis] EXB56621.1 E3 ubiquitin-protein ligase listerin [Morus notabilis] Length = 2006 Score = 62.4 bits (150), Expect = 5e-09 Identities = 25/52 (48%), Positives = 42/52 (80%) Frame = +1 Query: 10 HGVDYYQAFSPISFLNSVCVLNYVVVHPDWPLFQLDVKHAFLYGDMHKEIFM 165 +G+DY + F+P++ +NS+ VL + V+ +WPL+QLDVK+AFL G++ +E+FM Sbjct: 54 YGLDYQETFAPVAKINSIRVLLSLAVNSNWPLYQLDVKNAFLNGNLEEEVFM 105