BLASTX nr result
ID: Alisma22_contig00043132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043132 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016195745.1 PREDICTED: zinc finger MYM-type protein 1-like [A... 41 7e-06 XP_008245511.1 PREDICTED: zinc finger MYM-type protein 1-like [P... 45 9e-06 >XP_016195745.1 PREDICTED: zinc finger MYM-type protein 1-like [Arachis ipaensis] Length = 470 Score = 41.2 bits (95), Expect(2) = 7e-06 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = -1 Query: 214 LNKCQCQRHQHEFPWRTFGSKRCQFVPSWFDEHCNGL*CNIAKDS 80 L K CQ H+FP GS +F P+WFD++ N L +I+KD+ Sbjct: 47 LQKGPCQPRNHDFPQTACGSSFRRFNPNWFDDYGNWLEYSISKDA 91 Score = 35.8 bits (81), Expect(2) = 7e-06 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = -2 Query: 348 NSLHNFQRVSGVLYFKS*ANILDTRDRPPILHYHPSVQDVVRKAYL 211 NS+H + L F+ + I D RP I YHP+ +D VR AYL Sbjct: 2 NSIHQSSAIYNWLQFEVESLIADPGQRPKISSYHPNDRDKVRCAYL 47 >XP_008245511.1 PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume] Length = 788 Score = 44.7 bits (104), Expect(2) = 9e-06 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = -1 Query: 226 QKSILNKCQCQRHQHEFPWRTFGSKRCQFVPSWFDEHCNGL*CNIAKDSA 77 +++ L K CQ H FP++ FG+K+ +F P WF E L +I KD+A Sbjct: 62 RRAYLQKGPCQPRGHNFPYKNFGAKQRRFNPGWFSEFPTWLEYSIEKDAA 111 Score = 32.0 bits (71), Expect(2) = 9e-06 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 270 RPPILHYHPSVQDVVRKAYL 211 R IL YHP+VQD VR+AYL Sbjct: 47 RNQILSYHPNVQDQVRRAYL 66