BLASTX nr result
ID: Alisma22_contig00042977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00042977 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016476970.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 5e-08 XP_009630381.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 5e-08 XP_008806765.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 5e-08 XP_009780531.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 9e-08 XP_020092308.1 putative pentatricopeptide repeat-containing prot... 59 9e-08 CDP14700.1 unnamed protein product [Coffea canephora] 59 1e-07 OIT29697.1 putative pentatricopeptide repeat-containing protein ... 58 2e-07 XP_019230046.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-07 EEE60318.1 hypothetical protein OsJ_13399 [Oryza sativa Japonica... 58 2e-07 EEC76555.1 hypothetical protein OsI_14360 [Oryza sativa Indica G... 58 2e-07 XP_006650908.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-07 XP_015628588.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-07 OAY69967.1 putative pentatricopeptide repeat-containing protein ... 58 3e-07 XP_004981019.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 4e-07 XP_008665758.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 4e-07 OEL31020.1 putative pentatricopeptide repeat-containing protein ... 56 1e-06 KXG37106.1 hypothetical protein SORBI_001G009400 [Sorghum bicolor] 56 1e-06 XP_002463504.1 hypothetical protein SORBIDRAFT_01g000920 [Sorghu... 56 1e-06 EMT19690.1 hypothetical protein F775_17824 [Aegilops tauschii] 55 2e-06 KMZ65085.1 putative pentatricopeptide repeat-containing protein ... 55 2e-06 >XP_016476970.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Nicotiana tabacum] Length = 428 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN ANFVILA IYA +G+ EAEG+RREM +R M+ PGSSWV Sbjct: 382 ENPANFVILARIYATSGRFEEAEGLRREMIKRGMKAAPGSSWV 424 >XP_009630381.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Nicotiana tomentosiformis] Length = 428 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN ANFVILA IYA +G+ EAEG+RREM +R M+ PGSSWV Sbjct: 382 ENPANFVILARIYATSGRFEEAEGLRREMIKRGMKAAPGSSWV 424 >XP_008806765.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Phoenix dactylifera] Length = 429 Score = 60.1 bits (144), Expect = 5e-08 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSW 258 EN +FV+L++IYAAAGK EAE VRREME+R ++R PGSSW Sbjct: 382 ENAGSFVLLSSIYAAAGKYEEAERVRREMEERGVKRMPGSSW 423 >XP_009780531.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Nicotiana sylvestris] XP_016439791.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Nicotiana tabacum] Length = 428 Score = 59.3 bits (142), Expect = 9e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN ANFVILA IYA+ G+ EAEG+RREM +R M+ PGSSWV Sbjct: 382 ENPANFVILARIYASNGRFEEAEGLRREMIKRGMKAAPGSSWV 424 >XP_020092308.1 putative pentatricopeptide repeat-containing protein At1g03510 [Ananas comosus] Length = 433 Score = 59.3 bits (142), Expect = 9e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 +N NFV+L+++YA AG AEGV+REME+R +RR PGSSWV Sbjct: 382 QNAGNFVLLSSVYAGAGMHEAAEGVQREMEERGVRRLPGSSWV 424 >CDP14700.1 unnamed protein product [Coffea canephora] Length = 428 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSW 258 EN AN+VILA IYA AG+ +AE +RREM++R +R TPGSSW Sbjct: 382 ENPANYVILARIYANAGRPTKAEEIRREMKERGLRATPGSSW 423 >OIT29697.1 putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 338 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 +N ANFVILA IYA+ G+ EAEG+RREM +R M+ PGSSWV Sbjct: 292 DNPANFVILARIYASNGRFEEAEGLRREMIKRGMKAAPGSSWV 334 >XP_019230046.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Nicotiana attenuata] Length = 428 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 +N ANFVILA IYA+ G+ EAEG+RREM +R M+ PGSSWV Sbjct: 382 DNPANFVILARIYASNGRFEEAEGLRREMIKRGMKAAPGSSWV 424 >EEE60318.1 hypothetical protein OsJ_13399 [Oryza sativa Japonica Group] Length = 436 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRREMEQR +RR PGSSW+ Sbjct: 387 ENAGNFVSLANIYSGMGMHDKAEQVRREMEQRGVRRLPGSSWM 429 >EEC76555.1 hypothetical protein OsI_14360 [Oryza sativa Indica Group] Length = 436 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRREMEQR +RR PGSSW+ Sbjct: 387 ENAGNFVSLANIYSGMGMHDKAEQVRREMEQRGVRRLPGSSWM 429 >XP_006650908.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Oryza brachyantha] Length = 436 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSW 258 EN NFV LANIY+ G EAE VRR+MEQR +RR PGSSW Sbjct: 385 ENAGNFVSLANIYSGMGMHDEAERVRRDMEQRGVRRLPGSSW 426 >XP_015628588.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 isoform X1 [Oryza sativa Japonica Group] XP_015628589.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 isoform X1 [Oryza sativa Japonica Group] XP_015628590.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 isoform X1 [Oryza sativa Japonica Group] XP_015628591.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 isoform X1 [Oryza sativa Japonica Group] ABF99938.1 pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] BAG94831.1 unnamed protein product [Oryza sativa Japonica Group] BAS87399.1 Os03g0852000 [Oryza sativa Japonica Group] Length = 438 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRREMEQR +RR PGSSW+ Sbjct: 387 ENAGNFVSLANIYSGMGMHDKAEQVRREMEQRGVRRLPGSSWM 429 >OAY69967.1 putative pentatricopeptide repeat-containing protein [Ananas comosus] Length = 439 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSW 258 +N NFV+L+++YA AG AEGV+REME+R +RR PGSSW Sbjct: 382 QNAGNFVLLSSVYAGAGMHEAAEGVQREMEERGVRRLPGSSW 423 >XP_004981019.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Setaria italica] KQK86135.1 hypothetical protein SETIT_038671mg [Setaria italica] Length = 436 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRREMEQR ++R PGSSW+ Sbjct: 387 ENAGNFVSLANIYSGRGMHEDAERVRREMEQRGVQRLPGSSWM 429 >XP_008665758.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Zea mays] Length = 443 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRREMEQR ++R PGSSW+ Sbjct: 394 ENAGNFVSLANIYSGRGMHEDAERVRREMEQRGVQRLPGSSWM 436 >OEL31020.1 putative pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 403 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 +N NFV LANIY+ G +AE VRREMEQR ++R PGSSW+ Sbjct: 354 DNAGNFVSLANIYSGRGMHEDAERVRREMEQRGVQRLPGSSWM 396 >KXG37106.1 hypothetical protein SORBI_001G009400 [Sorghum bicolor] Length = 442 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRR+MEQR ++R PGSSW+ Sbjct: 393 ENAGNFVSLANIYSGRGMHEDAERVRRKMEQRGVQRLPGSSWM 435 >XP_002463504.1 hypothetical protein SORBIDRAFT_01g000920 [Sorghum bicolor] Length = 444 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 EN NFV LANIY+ G +AE VRR+MEQR ++R PGSSW+ Sbjct: 393 ENAGNFVSLANIYSGRGMHEDAERVRRKMEQRGVQRLPGSSWM 435 >EMT19690.1 hypothetical protein F775_17824 [Aegilops tauschii] Length = 361 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSW 258 EN NFV LAN+Y+ G EAE VRR+MEQR ++ +PGSSW Sbjct: 264 ENAGNFVSLANVYSGLGMHEEAERVRRDMEQRGLQSSPGSSW 305 >KMZ65085.1 putative pentatricopeptide repeat-containing protein [Zostera marina] Length = 419 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -2 Query: 383 ENTANFVILANIYAAAGKRVEAEGVRREMEQRYMRRTPGSSWV 255 +N NFVILANIYA+AG +A+ VR+EM +R ++R PGSSW+ Sbjct: 376 DNGGNFVILANIYASAGMFEKAQCVRKEMRERLVKRAPGSSWL 418