BLASTX nr result
ID: Alisma22_contig00042869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00042869 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN82537.1 hypothetical protein VITISV_013040 [Vitis vinifera] 52 7e-06 XP_009775479.1 PREDICTED: uncharacterized protein LOC104225398 [... 52 1e-05 >CAN82537.1 hypothetical protein VITISV_013040 [Vitis vinifera] Length = 680 Score = 52.0 bits (123), Expect = 7e-06 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -1 Query: 173 EVLQHPA*KAVMLEEMIRLCENET*DLIP-PPNKNIVDCR*VWSIKFNFDG*VQRIKS 3 E L P KAVM EEM L +NET +L+ PP KN+V CR ++++K+ DG ++R K+ Sbjct: 248 EALVDPRWKAVMNEEMKSLQKNETWELVECPPGKNLVGCRWIYTVKYKADGSIERFKA 305 >XP_009775479.1 PREDICTED: uncharacterized protein LOC104225398 [Nicotiana sylvestris] Length = 640 Score = 51.6 bits (122), Expect = 1e-05 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Frame = -1 Query: 209 SIYQDSEKLNYCEVLQHPA*KAVMLEEMIRLCENET*DLI-PPPNKNIVDCR*VWSIKFN 33 SI DSE ++ E +PA + M++E L N T DLI PPP K ++CR V+ +K Sbjct: 532 SICNDSEPSSFEEATINPAWQTAMVQEFEALYSNNTWDLIPPPPGKKAIECRWVYKVKHK 591 Query: 32 FDG*VQRIK 6 DG ++R K Sbjct: 592 ADGTIERFK 600