BLASTX nr result
ID: Alisma22_contig00042824
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00042824 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006351104.1 PREDICTED: F-box protein SKIP23-like [Solanum tub... 52 5e-06 >XP_006351104.1 PREDICTED: F-box protein SKIP23-like [Solanum tuberosum] Length = 433 Score = 52.0 bits (123), Expect = 5e-06 Identities = 19/41 (46%), Positives = 32/41 (78%) Frame = +2 Query: 104 LNRHNPMASWADLPRDILDQLVESLVQHLEVLRFSQVCKSW 226 ++R + MASW+DLP++I++++ ESL H+++ RF VC SW Sbjct: 5 MSRESKMASWSDLPKEIVEKISESLDSHIDITRFRAVCNSW 45