BLASTX nr result
ID: Alisma22_contig00042576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00042576 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008783406.1 PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-as... 56 2e-07 XP_008795599.1 PREDICTED: DDB1- and CUL4-associated factor homol... 55 5e-07 XP_019703984.1 PREDICTED: DDB1- and CUL4-associated factor homol... 53 3e-06 XP_010911880.1 PREDICTED: DDB1- and CUL4-associated factor homol... 53 3e-06 >XP_008783406.1 PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor homolog 1-like [Phoenix dactylifera] Length = 1964 Score = 56.2 bits (134), Expect = 2e-07 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +1 Query: 1 SNLTAIAYPLQKEASLIPLPSLNI-SQPLHKNSILETAYACLYWPSWCIPFGFLTNMIIM 177 S LTA A LQKEA L PLPSL + + PLH+ S+ ET+ L WPS P GFL+ + M Sbjct: 1206 SGLTATAALLQKEADLTPLPSLGVPTPPLHQTSVQETSNVQLQWPSGRAPCGFLSETVKM 1265 >XP_008795599.1 PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Phoenix dactylifera] Length = 1925 Score = 55.5 bits (132), Expect = 5e-07 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +1 Query: 1 SNLTAIAYPLQKEASLIPLPSLNI-SQPLHKNSILETAYACLYWPSWCIPFGFLTNMIIM 177 S LTA A LQKEA L PLPS + + PLH+ S+ ET+ A L WPS P GFL+ + M Sbjct: 1164 SGLTATAALLQKEADLTPLPSSGVPTPPLHQTSVQETSNAQLQWPSCRAPCGFLSEKVKM 1223 >XP_019703984.1 PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X2 [Elaeis guineensis] Length = 1759 Score = 53.1 bits (126), Expect = 3e-06 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +1 Query: 1 SNLTAIAYPLQKEASLIPLPSLNI-SQPLHKNSILETAYACLYWPSWCIPFGFLTNMIIM 177 S LTA A LQKEA L PLPSL + + PLH+ S+ ET+ L WPS GFL+ ++ M Sbjct: 1210 SGLTATAALLQKEADLTPLPSLGVLTPPLHQTSVQETSNVQLQWPSGRALCGFLSEIVKM 1269 >XP_010911880.1 PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X1 [Elaeis guineensis] Length = 1972 Score = 53.1 bits (126), Expect = 3e-06 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +1 Query: 1 SNLTAIAYPLQKEASLIPLPSLNI-SQPLHKNSILETAYACLYWPSWCIPFGFLTNMIIM 177 S LTA A LQKEA L PLPSL + + PLH+ S+ ET+ L WPS GFL+ ++ M Sbjct: 1210 SGLTATAALLQKEADLTPLPSLGVLTPPLHQTSVQETSNVQLQWPSGRALCGFLSEIVKM 1269