BLASTX nr result
ID: Alisma22_contig00040873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040873 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019051558.1 PREDICTED: serine/threonine-protein phosphatase P... 57 1e-07 NP_001324021.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 55 4e-07 CAA87387.1 Ser/Thr protein phosphatase homologous to PP2A, parti... 54 6e-07 XP_018629412.1 PREDICTED: serine/threonine-protein phosphatase P... 55 1e-06 AIT76552.1 serine/threonine-protein phosphatase, partial [Polian... 54 1e-06 XP_008813487.1 PREDICTED: serine/threonine-protein phosphatase P... 54 2e-06 ONH95679.1 hypothetical protein PRUPE_7G084700 [Prunus persica] 54 3e-06 XP_019242151.1 PREDICTED: serine/threonine-protein phosphatase P... 53 3e-06 XP_013663502.1 PREDICTED: serine/threonine-protein phosphatase P... 54 3e-06 XP_017181575.1 PREDICTED: serine/threonine-protein phosphatase P... 54 3e-06 CDX67746.1 BnaA07g17860D [Brassica napus] 54 3e-06 XP_019577453.1 PREDICTED: serine/threonine-protein phosphatase P... 54 3e-06 XP_019577391.1 PREDICTED: serine/threonine-protein phosphatase P... 54 3e-06 KZV50989.1 protein phsophatase-2a [Dorcoceras hygrometricum] 54 3e-06 EPS72615.1 serine/threonine-protein phosphatase, partial [Genlis... 54 4e-06 ONH95677.1 hypothetical protein PRUPE_7G084700 [Prunus persica] 54 4e-06 ONH95678.1 hypothetical protein PRUPE_7G084700 [Prunus persica] 54 4e-06 XP_008813488.1 PREDICTED: serine/threonine-protein phosphatase P... 54 4e-06 XP_017622894.1 PREDICTED: serine/threonine-protein phosphatase P... 54 4e-06 XP_017622891.1 PREDICTED: serine/threonine-protein phosphatase P... 54 4e-06 >XP_019051558.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like [Nelumbo nucifera] Length = 194 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALVCTSATFIQLILFLKS 223 YGNANVWKIFTDLFDYFPLTALV +F L L+ S Sbjct: 69 YGNANVWKIFTDLFDYFPLTALVSRILSFCYLELYYYS 106 >NP_001324021.1 protein phosphatase 2A-3 [Arabidopsis thaliana] ANM61824.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 180 Score = 55.5 bits (132), Expect = 4e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALVCTSAT 253 YGNANVWKIFTDLFDYFPLTALV T T Sbjct: 144 YGNANVWKIFTDLFDYFPLTALVSTYHT 171 >CAA87387.1 Ser/Thr protein phosphatase homologous to PP2A, partial [Malus domestica] Length = 104 Score = 53.5 bits (127), Expect = 6e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 47 YGNANVWKIFTDLFDYFPLTALV 69 >XP_018629412.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit isoform X3 [Nicotiana tomentosiformis] Length = 233 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALVCTSATFIQL-ILFLKSVLCYMVVY 199 YGNANVWK FTDLFDYFPLTAL +++T + L +L L + + VY Sbjct: 140 YGNANVWKTFTDLFDYFPLTALRFSASTVVCLHLLKLLIIFAILTVY 186 >AIT76552.1 serine/threonine-protein phosphatase, partial [Polianthes tuberosa] Length = 152 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 49 YGNANVWKIFTDLFDYFPLTALV 71 >XP_008813487.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like isoform X3 [Phoenix dactylifera] Length = 166 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 138 YGNANVWKIFTDLFDYFPLTALV 160 >ONH95679.1 hypothetical protein PRUPE_7G084700 [Prunus persica] Length = 192 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 20 YGNANVWKIFTDLFDYFPLTALV 42 >XP_019242151.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Nicotiana attenuata] Length = 168 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALVCTSATF 250 YGNANVWK FTDLFDYFPLTALV ++F Sbjct: 140 YGNANVWKTFTDLFDYFPLTALVSIISSF 168 >XP_013663502.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like [Brassica napus] Length = 197 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 25 YGNANVWKIFTDLFDYFPLTALV 47 >XP_017181575.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like, partial [Malus domestica] Length = 200 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 37 YGNANVWKIFTDLFDYFPLTALV 59 >CDX67746.1 BnaA07g17860D [Brassica napus] Length = 203 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 31 YGNANVWKIFTDLFDYFPLTALV 53 >XP_019577453.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit, partial [Rhinolophus sinicus] Length = 209 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 37 YGNANVWKIFTDLFDYFPLTALV 59 >XP_019577391.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit, partial [Rhinolophus sinicus] Length = 210 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 38 YGNANVWKIFTDLFDYFPLTALV 60 >KZV50989.1 protein phsophatase-2a [Dorcoceras hygrometricum] Length = 222 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 116 YGNANVWKIFTDLFDYFPLTALV 138 >EPS72615.1 serine/threonine-protein phosphatase, partial [Genlisea aurea] Length = 226 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 141 YGNANVWKIFTDLFDYFPLTALV 163 >ONH95677.1 hypothetical protein PRUPE_7G084700 [Prunus persica] Length = 227 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 55 YGNANVWKIFTDLFDYFPLTALV 77 >ONH95678.1 hypothetical protein PRUPE_7G084700 [Prunus persica] Length = 228 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 56 YGNANVWKIFTDLFDYFPLTALV 78 >XP_008813488.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like [Phoenix dactylifera] Length = 247 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 75 YGNANVWKIFTDLFDYFPLTALV 97 >XP_017622894.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit isoform X4 [Gossypium arboreum] Length = 249 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 140 YGNANVWKIFTDLFDYFPLTALV 162 >XP_017622891.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit isoform X3 [Gossypium arboreum] XP_017622892.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit isoform X3 [Gossypium arboreum] XP_017622893.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit isoform X3 [Gossypium arboreum] Length = 258 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 336 YGNANVWKIFTDLFDYFPLTALV 268 YGNANVWKIFTDLFDYFPLTALV Sbjct: 55 YGNANVWKIFTDLFDYFPLTALV 77