BLASTX nr result
ID: Alisma22_contig00040779
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040779 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU29942.1 hypothetical protein MIMGU_mgv1a009431mg [Erythranthe... 87 2e-18 KQL06536.1 hypothetical protein SETIT_004045mg, partial [Setaria... 87 2e-18 XP_012846076.1 PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and B3 do... 87 3e-18 XP_010262942.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 87 3e-18 XP_004969625.1 PREDICTED: AP2/ERF and B3 domain-containing prote... 87 3e-18 XP_010044293.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 87 4e-18 XP_010265251.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 86 7e-18 XP_015895705.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 86 8e-18 XP_015895704.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 86 8e-18 AGT55822.1 tempranillo [Antirrhinum majus] 86 9e-18 EAZ13178.1 hypothetical protein OsJ_03098 [Oryza sativa Japonica... 84 9e-18 XP_015691223.1 PREDICTED: AP2/ERF and B3 domain-containing prote... 84 1e-17 XP_011070834.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 86 1e-17 CDP00578.1 unnamed protein product [Coffea canephora] 86 1e-17 XP_009393568.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 85 2e-17 OEL37843.1 AP2/ERF and B3 domain-containing protein [Dichantheli... 85 2e-17 XP_018859781.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 85 2e-17 XP_004297140.1 PREDICTED: AP2/ERF and B3 domain-containing trans... 85 2e-17 JAT67517.1 AP2/ERF and B3 domain-containing protein Os01g0693400... 85 2e-17 AEZ02303.1 RAV1 [Castanea sativa] 84 3e-17 >EYU29942.1 hypothetical protein MIMGU_mgv1a009431mg [Erythranthe guttata] Length = 342 Score = 87.0 bits (214), Expect = 2e-18 Identities = 46/64 (71%), Positives = 52/64 (81%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R + A EQLF+KAVTPSDVGKLNRLVIPK HAE++FPL+ S TSKG LL+FED AG Sbjct: 158 RAAKAREQLFEKAVTPSDVGKLNRLVIPKQHAERHFPLQSGS---TSKGVLLNFED--AG 212 Query: 265 GKVW 276 GKVW Sbjct: 213 GKVW 216 >KQL06536.1 hypothetical protein SETIT_004045mg, partial [Setaria italica] Length = 359 Score = 87.0 bits (214), Expect = 2e-18 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = +1 Query: 91 SSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGK 270 ++A E LFDK VTPSDVGKLNRLVIPK HAEK+FPL++ S+ SKG LL+FED AGGK Sbjct: 207 AAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFED--AGGK 264 Query: 271 VW 276 VW Sbjct: 265 VW 266 >XP_012846076.1 PREDICTED: LOW QUALITY PROTEIN: AP2/ERF and B3 domain-containing transcription factor RAV1-like [Erythranthe guttata] Length = 363 Score = 87.0 bits (214), Expect = 3e-18 Identities = 46/64 (71%), Positives = 52/64 (81%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R + A EQLF+KAVTPSDVGKLNRLVIPK HAE++FPL+ S TSKG LL+FED AG Sbjct: 179 RAAKAREQLFEKAVTPSDVGKLNRLVIPKQHAERHFPLQSGS---TSKGVLLNFED--AG 233 Query: 265 GKVW 276 GKVW Sbjct: 234 GKVW 237 >XP_010262942.1 PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like [Nelumbo nucifera] Length = 365 Score = 87.0 bits (214), Expect = 3e-18 Identities = 47/64 (73%), Positives = 51/64 (79%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R + A E LFDKAVTPSDVGKLNRLVIPK HAEK+FPL+I S TSKG LL+FED G Sbjct: 183 RAAKARELLFDKAVTPSDVGKLNRLVIPKQHAEKHFPLQIGS---TSKGVLLNFED--NG 237 Query: 265 GKVW 276 GKVW Sbjct: 238 GKVW 241 >XP_004969625.1 PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like [Setaria italica] Length = 398 Score = 87.0 bits (214), Expect = 3e-18 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = +1 Query: 91 SSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGK 270 ++A E LFDK VTPSDVGKLNRLVIPK HAEK+FPL++ S+ SKG LL+FED AGGK Sbjct: 207 AAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFED--AGGK 264 Query: 271 VW 276 VW Sbjct: 265 VW 266 >XP_010044293.1 PREDICTED: AP2/ERF and B3 domain-containing transcription repressor TEM1 [Eucalyptus grandis] KCW86364.1 hypothetical protein EUGRSUZ_B03048 [Eucalyptus grandis] Length = 364 Score = 86.7 bits (213), Expect = 4e-18 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +1 Query: 109 LFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGKVW 276 LF+KAVTPSDVGKLNRLVIPK HAEK+FPLR +S TSKG LL+FED +GGKVW Sbjct: 196 LFEKAVTPSDVGKLNRLVIPKQHAEKHFPLRNGTSSATSKGVLLNFED--SGGKVW 249 >XP_010265251.1 PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like [Nelumbo nucifera] Length = 365 Score = 85.9 bits (211), Expect = 7e-18 Identities = 47/64 (73%), Positives = 51/64 (79%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R + A EQLFDKAVTPSDVGKLNRLVIPK HAEK+FPL+I S TSK LL+FED G Sbjct: 184 RVAKAREQLFDKAVTPSDVGKLNRLVIPKQHAEKHFPLQIGS---TSKCVLLNFED--NG 238 Query: 265 GKVW 276 GKVW Sbjct: 239 GKVW 242 >XP_015895705.1 PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like isoform X2 [Ziziphus jujuba] Length = 389 Score = 85.9 bits (211), Expect = 8e-18 Identities = 46/64 (71%), Positives = 50/64 (78%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ S TSKG LL+FED G Sbjct: 210 RVQKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS---TSKGVLLNFED--VG 264 Query: 265 GKVW 276 GKVW Sbjct: 265 GKVW 268 >XP_015895704.1 PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like isoform X1 [Ziziphus jujuba] Length = 390 Score = 85.9 bits (211), Expect = 8e-18 Identities = 46/64 (71%), Positives = 50/64 (78%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ S TSKG LL+FED G Sbjct: 211 RVQKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS---TSKGVLLNFED--VG 265 Query: 265 GKVW 276 GKVW Sbjct: 266 GKVW 269 >AGT55822.1 tempranillo [Antirrhinum majus] Length = 354 Score = 85.5 bits (210), Expect = 9e-18 Identities = 46/67 (68%), Positives = 53/67 (79%), Gaps = 4/67 (5%) Frame = +1 Query: 88 KSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRIS----SSICTSKGALLSFEDA 255 K+ A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ + +S TSKG LL+FED Sbjct: 179 KARAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNNGNNGNSSSTSKGVLLNFED- 237 Query: 256 RAGGKVW 276 GGKVW Sbjct: 238 -VGGKVW 243 >EAZ13178.1 hypothetical protein OsJ_03098 [Oryza sativa Japonica Group] Length = 231 Score = 83.6 bits (205), Expect = 9e-18 Identities = 42/62 (67%), Positives = 50/62 (80%) Frame = +1 Query: 91 SSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGK 270 ++A + LFDK VTPSDVGKLNRLVIPK HAEK+FPL++ S+ SKG LL+FED A GK Sbjct: 47 AAARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFED--AAGK 104 Query: 271 VW 276 VW Sbjct: 105 VW 106 >XP_015691223.1 PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400 [Oryza brachyantha] Length = 234 Score = 83.6 bits (205), Expect = 1e-17 Identities = 42/62 (67%), Positives = 50/62 (80%) Frame = +1 Query: 91 SSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGK 270 ++A + LFDK VTPSDVGKLNRLVIPK HAEK+FPL++ S+ SKG LL+FED A GK Sbjct: 47 AAARDHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFED--AAGK 104 Query: 271 VW 276 VW Sbjct: 105 VW 106 >XP_011070834.1 PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like [Sesamum indicum] Length = 374 Score = 85.5 bits (210), Expect = 1e-17 Identities = 45/64 (70%), Positives = 52/64 (81%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R ++A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ + TSKG LL+FED G Sbjct: 178 RAANAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGN---TSKGVLLNFED--MG 232 Query: 265 GKVW 276 GKVW Sbjct: 233 GKVW 236 >CDP00578.1 unnamed protein product [Coffea canephora] Length = 378 Score = 85.5 bits (210), Expect = 1e-17 Identities = 44/66 (66%), Positives = 53/66 (80%) Frame = +1 Query: 79 FRRKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDAR 258 +++ + A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ + TSKG LL+FED Sbjct: 191 YQKTTKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGN---TSKGVLLNFED-- 245 Query: 259 AGGKVW 276 GGKVW Sbjct: 246 MGGKVW 251 >XP_009393568.1 PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like [Musa acuminata subsp. malaccensis] Length = 341 Score = 84.7 bits (208), Expect = 2e-17 Identities = 45/61 (73%), Positives = 48/61 (78%) Frame = +1 Query: 94 SALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGKV 273 SA LFDK VTPSDVGKLNRLVIPK HAEKYFPL SS+ SKG LL+FED AGG+V Sbjct: 173 SARLMLFDKVVTPSDVGKLNRLVIPKQHAEKYFPLESGSSV-ASKGVLLNFED--AGGRV 229 Query: 274 W 276 W Sbjct: 230 W 230 >OEL37843.1 AP2/ERF and B3 domain-containing protein [Dichanthelium oligosanthes] Length = 395 Score = 85.1 bits (209), Expect = 2e-17 Identities = 43/62 (69%), Positives = 51/62 (82%) Frame = +1 Query: 91 SSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGK 270 ++A E LFDKAVTPSDVGKLNRLVIPK HAEK+FPL++ S+ +KG LL+FEDA GK Sbjct: 211 AAAREHLFDKAVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGETKGVLLNFEDAE--GK 268 Query: 271 VW 276 VW Sbjct: 269 VW 270 >XP_018859781.1 PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like [Juglans regia] Length = 379 Score = 84.7 bits (208), Expect = 2e-17 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ S T+KG LL+FED G Sbjct: 195 RAFKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQTGS---TTKGVLLNFED--VG 249 Query: 265 GKVW 276 GKVW Sbjct: 250 GKVW 253 >XP_004297140.1 PREDICTED: AP2/ERF and B3 domain-containing transcription repressor TEM1-like [Fragaria vesca subsp. vesca] Length = 383 Score = 84.7 bits (208), Expect = 2e-17 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = +1 Query: 85 RKSSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAG 264 R + A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ S T KG LL+FED G Sbjct: 202 RAAKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGS---TCKGVLLNFED--VG 256 Query: 265 GKVW 276 GKVW Sbjct: 257 GKVW 260 >JAT67517.1 AP2/ERF and B3 domain-containing protein Os01g0693400, partial [Anthurium amnicola] Length = 508 Score = 85.1 bits (209), Expect = 2e-17 Identities = 43/62 (69%), Positives = 48/62 (77%) Frame = +1 Query: 91 SSALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICTSKGALLSFEDARAGGK 270 S EQLFDKAVTPSDVGKLNRLVIPK HAEK+FPL++ + SKG LL+ ED GGK Sbjct: 215 SERREQLFDKAVTPSDVGKLNRLVIPKQHAEKHFPLQLGGAAGCSKGVLLNLED--PGGK 272 Query: 271 VW 276 VW Sbjct: 273 VW 274 >AEZ02303.1 RAV1 [Castanea sativa] Length = 383 Score = 84.3 bits (207), Expect = 3e-17 Identities = 46/62 (74%), Positives = 50/62 (80%), Gaps = 2/62 (3%) Frame = +1 Query: 97 ALEQLFDKAVTPSDVGKLNRLVIPKHHAEKYFPLRISSSICT--SKGALLSFEDARAGGK 270 A EQLF+KAVTPSDVGKLNRLVIPK HAEK+FPL+ S S T SKG LL+FED GGK Sbjct: 204 AREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQNSGSNSTTSSKGLLLNFED--VGGK 261 Query: 271 VW 276 VW Sbjct: 262 VW 263