BLASTX nr result
ID: Alisma22_contig00040536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040536 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ57820.1 putative Pentatricopeptide repeat-containing protein ... 63 3e-09 OEL33151.1 Pentatricopeptide repeat-containing protein OTP51, ch... 60 1e-08 XP_009387640.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 KZV41149.1 pentatricopeptide repeat-containing protein [Dorcocer... 61 2e-08 ADB85413.1 putative endonuclease [Phyllostachys edulis] 61 2e-08 XP_003570175.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 XP_008646124.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 AGT16734.1 pentatricopeptide repeat-containing protein [Saccharu... 60 3e-08 XP_002454427.1 hypothetical protein SORBIDRAFT_04g030740 [Sorghu... 60 3e-08 OAY69657.1 Pentatricopeptide repeat-containing protein OTP51, ch... 60 4e-08 XP_020083927.1 pentatricopeptide repeat-containing protein OTP51... 60 4e-08 EPS74001.1 hypothetical protein M569_00754 [Genlisea aurea] 60 4e-08 XP_004953589.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 8e-08 XP_010530875.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_020196263.1 pentatricopeptide repeat-containing protein OTP51... 58 2e-07 XP_015626611.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 ONH91458.1 hypothetical protein PRUPE_8G116000 [Prunus persica] 58 3e-07 XP_012836976.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 58 3e-07 XP_007201413.1 hypothetical protein PRUPE_ppa001679mg [Prunus pe... 58 3e-07 KFK40039.1 hypothetical protein AALP_AA3G322000 [Arabis alpina] 58 3e-07 >KMZ57820.1 putative Pentatricopeptide repeat-containing protein [Zostera marina] Length = 732 Score = 63.2 bits (152), Expect = 3e-09 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 247 EDQLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 ++ L+V ELEDLPEQWRR+K AWLCKE+PSH+H+ TR Sbjct: 52 DEILKVKELEDLPEQWRRSKVAWLCKELPSHKHSTLTR 89 >OEL33151.1 Pentatricopeptide repeat-containing protein OTP51, chloroplastic [Dichanthelium oligosanthes] Length = 221 Score = 60.5 bits (145), Expect = 1e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 102 ELEVFELEELPEQWRRSRIAWLCKELPAYKHSTFTR 137 >XP_009387640.1 PREDICTED: pentatricopeptide repeat-containing protein OTP51, chloroplastic [Musa acuminata subsp. malaccensis] Length = 788 Score = 61.2 bits (147), Expect = 2e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR+K AWLCKE+PS++H+ F R Sbjct: 101 ELEVKELEELPEQWRRSKIAWLCKELPSYKHSTFVR 136 >KZV41149.1 pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 805 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 244 DEDQLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 D +EV ELE+LPEQWRR+K AWLCKE+P+HR + FTR Sbjct: 106 DSPVVEVKELEELPEQWRRSKLAWLCKELPAHRSSTFTR 144 >ADB85413.1 putative endonuclease [Phyllostachys edulis] Length = 787 Score = 60.8 bits (146), Expect = 2e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 98 ELEVPELEELPEQWRRSRIAWLCKELPAYKHSTFTR 133 >XP_003570175.1 PREDICTED: pentatricopeptide repeat-containing protein OTP51, chloroplastic [Brachypodium distachyon] KQK00904.1 hypothetical protein BRADI_3g52580 [Brachypodium distachyon] Length = 787 Score = 60.8 bits (146), Expect = 2e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 98 ELEVPELEELPEQWRRSRIAWLCKELPAYKHSTFTR 133 >XP_008646124.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Zea mays] AQK73919.1 Pentatricopeptide repeat-containing protein chloroplastic [Zea mays] Length = 783 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 94 ELEVFELEELPEQWRRSRIAWLCKELPAYKHSTFTR 129 >AGT16734.1 pentatricopeptide repeat-containing protein [Saccharum hybrid cultivar R570] Length = 789 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 100 ELEVFELEELPEQWRRSRIAWLCKELPAYKHSTFTR 135 >XP_002454427.1 hypothetical protein SORBIDRAFT_04g030740 [Sorghum bicolor] EES07403.1 hypothetical protein SORBI_004G269600 [Sorghum bicolor] Length = 794 Score = 60.5 bits (145), Expect = 3e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 105 ELEVFELEELPEQWRRSRIAWLCKELPAYKHSTFTR 140 >OAY69657.1 Pentatricopeptide repeat-containing protein OTP51, chloroplastic [Ananas comosus] Length = 813 Score = 60.1 bits (144), Expect = 4e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LE ELEDLPEQWRR++ AWLCKE+PS++H+ F R Sbjct: 121 ELEAIELEDLPEQWRRSRIAWLCKELPSYKHSTFVR 156 >XP_020083927.1 pentatricopeptide repeat-containing protein OTP51, chloroplastic [Ananas comosus] Length = 814 Score = 60.1 bits (144), Expect = 4e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LE ELEDLPEQWRR++ AWLCKE+PS++H+ F R Sbjct: 122 ELEAIELEDLPEQWRRSRIAWLCKELPSYKHSTFVR 157 >EPS74001.1 hypothetical protein M569_00754 [Genlisea aurea] Length = 850 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 256 LEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +EV ELE+LPEQWRRAK AWLCKE+P+HR A F R Sbjct: 161 VEVKELEELPEQWRRAKLAWLCKELPAHRSATFIR 195 >XP_004953589.1 PREDICTED: pentatricopeptide repeat-containing protein OTP51, chloroplastic-like [Setaria italica] KQL31112.1 hypothetical protein SETIT_016353mg [Setaria italica] Length = 793 Score = 59.3 bits (142), Expect = 8e-08 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +L+V ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 105 ELQVFELEELPEQWRRSRIAWLCKELPAYKHSTFTR 140 >XP_010530875.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Tarenaya hassleriana] Length = 844 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 247 EDQLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 E ++EV ELEDLPEQWRR+K AWLCKE+PSH+ R Sbjct: 159 ETEVEVKELEDLPEQWRRSKIAWLCKELPSHKAGTLMR 196 >XP_020196263.1 pentatricopeptide repeat-containing protein OTP51, chloroplastic-like [Aegilops tauschii subsp. tauschii] XP_020159576.1 pentatricopeptide repeat-containing protein OTP51, chloroplastic-like [Aegilops tauschii subsp. tauschii] EMT05105.1 Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 785 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +L V ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 97 ELVVPELEELPEQWRRSRIAWLCKELPAYKHSTFTR 132 >XP_015626611.1 PREDICTED: pentatricopeptide repeat-containing protein OTP51, chloroplastic [Oryza sativa Japonica Group] Q6ZHJ5.1 RecName: Full=Pentatricopeptide repeat-containing protein OTP51, chloroplastic; AltName: Full=Protein ORGANELLE TRANSCRIPT PROCESSING 51; Short=OsOTP51; Flags: Precursor BAD07548.1 pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] EAZ24309.1 hypothetical protein OsJ_08060 [Oryza sativa Japonica Group] BAF09761.2 Os02g0702000 [Oryza sativa Japonica Group] AEX88471.1 PLS [Oryza sativa Japonica Group] BAS80476.1 Os02g0702000 [Oryza sativa Japonica Group] Length = 790 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +L V ELE+LPEQWRR++ AWLCKE+P+++H+ FTR Sbjct: 101 ELVVPELEELPEQWRRSRIAWLCKELPAYKHSTFTR 136 >ONH91458.1 hypothetical protein PRUPE_8G116000 [Prunus persica] Length = 763 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELEDLPEQWRR+K AWLCKE+P+H+ +R Sbjct: 97 ELEVPELEDLPEQWRRSKLAWLCKELPAHKAGTLSR 132 >XP_012836976.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15820 [Erythranthe guttata] Length = 781 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 256 LEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +EV EL+DLPEQWRR+K AWLCKE+P+HR F R Sbjct: 101 VEVKELDDLPEQWRRSKLAWLCKELPAHRSGTFIR 135 >XP_007201413.1 hypothetical protein PRUPE_ppa001679mg [Prunus persica] Length = 781 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 253 QLEVTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 +LEV ELEDLPEQWRR+K AWLCKE+P+H+ +R Sbjct: 115 ELEVPELEDLPEQWRRSKLAWLCKELPAHKAGTLSR 150 >KFK40039.1 hypothetical protein AALP_AA3G322000 [Arabis alpina] Length = 817 Score = 57.8 bits (138), Expect = 3e-07 Identities = 34/93 (36%), Positives = 46/93 (49%), Gaps = 4/93 (4%) Frame = +1 Query: 94 SSEVCTSSYSANSRRHHLWLIPGVTVSLPKRR----FSSQXXXXXXXXXXXXXXDEDQLE 261 S+ TS+ +A R + + G+T S R F E ++E Sbjct: 84 SNRAFTSNSAAERSRTFVEHLTGITESAEGRNELYDFGDVEAARNDAMNFASRRVETEVE 143 Query: 262 VTELEDLPEQWRRAKGAWLCKEVPSHRHAPFTR 360 V ELE+LPE+WRR+K AWLCKEVPSH+ R Sbjct: 144 VRELEELPEEWRRSKLAWLCKEVPSHKAVTLVR 176