BLASTX nr result
ID: Alisma22_contig00040400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040400 (224 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019194634.1 PREDICTED: respiratory burst oxidase homolog prot... 86 5e-18 XP_009799189.1 PREDICTED: respiratory burst oxidase homolog prot... 81 3e-16 XP_009799187.1 PREDICTED: respiratory burst oxidase homolog prot... 81 3e-16 XP_016461963.1 PREDICTED: respiratory burst oxidase homolog prot... 81 4e-16 XP_009771697.1 PREDICTED: respiratory burst oxidase homolog prot... 81 4e-16 OIT22135.1 respiratory burst oxidase -like protein e, partial [N... 80 5e-16 XP_016452611.1 PREDICTED: respiratory burst oxidase homolog prot... 80 5e-16 XP_009609859.2 PREDICTED: respiratory burst oxidase homolog prot... 80 5e-16 XP_019237854.1 PREDICTED: respiratory burst oxidase homolog prot... 80 5e-16 XP_019249202.1 PREDICTED: respiratory burst oxidase homolog prot... 80 5e-16 XP_018628783.1 PREDICTED: respiratory burst oxidase homolog prot... 80 5e-16 XP_016500658.1 PREDICTED: respiratory burst oxidase homolog prot... 80 7e-16 XP_009769453.1 PREDICTED: respiratory burst oxidase homolog prot... 80 7e-16 XP_019070517.1 PREDICTED: respiratory burst oxidase homolog prot... 80 7e-16 XP_015082837.1 PREDICTED: respiratory burst oxidase homolog prot... 80 9e-16 XP_006353773.1 PREDICTED: respiratory burst oxidase homolog prot... 79 1e-15 XP_006353772.1 PREDICTED: respiratory burst oxidase homolog prot... 79 1e-15 XP_016509587.1 PREDICTED: respiratory burst oxidase homolog prot... 79 2e-15 KCW79354.1 hypothetical protein EUGRSUZ_C00773 [Eucalyptus grandis] 79 2e-15 XP_019245814.1 PREDICTED: respiratory burst oxidase homolog prot... 79 2e-15 >XP_019194634.1 PREDICTED: respiratory burst oxidase homolog protein E [Ipomoea nil] Length = 951 Score = 86.3 bits (212), Expect = 5e-18 Identities = 39/73 (53%), Positives = 52/73 (71%) Frame = +1 Query: 4 SGNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRS 183 S +S + S ++ +RA+ + CLVL+NW+R W+LLLWFIAM ALFTWKFLQY+ Sbjct: 358 SAGRSQNLGTRNSKNVLKRASC--ALRCLVLENWQRGWILLLWFIAMGALFTWKFLQYKQ 415 Query: 184 SPAFHVLGYCLPT 222 AFH++GYCL T Sbjct: 416 KAAFHIMGYCLTT 428 >XP_009799189.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana sylvestris] XP_016485369.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana tabacum] Length = 926 Score = 81.3 bits (199), Expect = 3e-16 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +1 Query: 7 GNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSS 186 G L +R + ++ +RA+ G CLVLDNW+R W+LLLW + M LFTWKFLQYR Sbjct: 359 GWSQNLGTRSKTRNLVKRASYGLK--CLVLDNWQRAWILLLWVMIMAGLFTWKFLQYRRR 416 Query: 187 PAFHVLGYCLPT 222 AF V+GYCL T Sbjct: 417 AAFQVMGYCLAT 428 >XP_009799187.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana sylvestris] XP_009799188.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana sylvestris] XP_016485368.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana tabacum] Length = 950 Score = 81.3 bits (199), Expect = 3e-16 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +1 Query: 7 GNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSS 186 G L +R + ++ +RA+ G CLVLDNW+R W+LLLW + M LFTWKFLQYR Sbjct: 359 GWSQNLGTRSKTRNLVKRASYGLK--CLVLDNWQRAWILLLWVMIMAGLFTWKFLQYRRR 416 Query: 187 PAFHVLGYCLPT 222 AF V+GYCL T Sbjct: 417 AAFQVMGYCLAT 428 >XP_016461963.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana tabacum] Length = 944 Score = 80.9 bits (198), Expect = 4e-16 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +1 Query: 85 CLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLP 219 CLVL NW+R W+LLLW I M LFTWKFLQYR AFHV+GYCLP Sbjct: 377 CLVLKNWQRGWILLLWMITMAGLFTWKFLQYRQRAAFHVMGYCLP 421 >XP_009771697.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana sylvestris] Length = 944 Score = 80.9 bits (198), Expect = 4e-16 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +1 Query: 85 CLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLP 219 CLVL NW+R W+LLLW I M LFTWKFLQYR AFHV+GYCLP Sbjct: 377 CLVLKNWQRGWILLLWMITMAGLFTWKFLQYRQRAAFHVMGYCLP 421 >OIT22135.1 respiratory burst oxidase -like protein e, partial [Nicotiana attenuata] Length = 906 Score = 80.5 bits (197), Expect = 5e-16 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +1 Query: 85 CLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLP 219 CLVL NW+R W+LLLW I M LFTWKFLQYR AFHV+GYCLP Sbjct: 375 CLVLKNWQRGWILLLWMITMAGLFTWKFLQYRQRAAFHVVGYCLP 419 >XP_016452611.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana tabacum] Length = 906 Score = 80.5 bits (197), Expect = 5e-16 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +1 Query: 7 GNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSS 186 G L +R + ++ +RA+ G CLVLDNW+R W+LLLW + M LFTWKFLQYR Sbjct: 357 GWSQNLGTRSKTRNLVKRASYGLK--CLVLDNWQRGWILLLWVMIMAGLFTWKFLQYRRR 414 Query: 187 PAFHVLGYCLPT 222 AF V+GYCL T Sbjct: 415 AAFQVMGYCLTT 426 >XP_009609859.2 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana tomentosiformis] Length = 933 Score = 80.5 bits (197), Expect = 5e-16 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +1 Query: 7 GNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSS 186 G L +R + ++ +RA+ G CLVLDNW+R W+LLLW + M LFTWKFLQYR Sbjct: 366 GWSQNLGTRSKTRNLVKRASYGLK--CLVLDNWQRGWILLLWVMIMAGLFTWKFLQYRRR 423 Query: 187 PAFHVLGYCLPT 222 AF V+GYCL T Sbjct: 424 AAFQVMGYCLTT 435 >XP_019237854.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana attenuata] Length = 942 Score = 80.5 bits (197), Expect = 5e-16 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +1 Query: 85 CLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLP 219 CLVL NW+R W+LLLW I M LFTWKFLQYR AFHV+GYCLP Sbjct: 375 CLVLKNWQRGWILLLWMITMAGLFTWKFLQYRQRAAFHVVGYCLP 419 >XP_019249202.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana attenuata] XP_019249203.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana attenuata] XP_019249204.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana attenuata] OIS99950.1 respiratory burst oxidase -like protein e [Nicotiana attenuata] Length = 946 Score = 80.5 bits (197), Expect = 5e-16 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +1 Query: 7 GNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSS 186 G L +R + ++ +RA+ G CLVLDNW+R W+LLLW + M LFTWKFLQYR Sbjct: 355 GWSQNLGTRSKTRNLVKRASYGLK--CLVLDNWQRGWILLLWVMIMAGLFTWKFLQYRRR 412 Query: 187 PAFHVLGYCLPT 222 AF V+GYCL T Sbjct: 413 AAFQVMGYCLAT 424 >XP_018628783.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana tomentosiformis] XP_009609858.2 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana tomentosiformis] Length = 957 Score = 80.5 bits (197), Expect = 5e-16 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +1 Query: 7 GNQSGLISRPTSSSMFRRATAGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSS 186 G L +R + ++ +RA+ G CLVLDNW+R W+LLLW + M LFTWKFLQYR Sbjct: 366 GWSQNLGTRSKTRNLVKRASYGLK--CLVLDNWQRGWILLLWVMIMAGLFTWKFLQYRRR 423 Query: 187 PAFHVLGYCLPT 222 AF V+GYCL T Sbjct: 424 AAFQVMGYCLTT 435 >XP_016500658.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana tabacum] Length = 741 Score = 80.1 bits (196), Expect = 7e-16 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A + CLVLDNW+R W+LLLW AM ALFTWKFLQYR AF V+GYCL T Sbjct: 356 ASCALKCLVLDNWQRGWILLLWLSAMTALFTWKFLQYRQMAAFQVMGYCLAT 407 >XP_009769453.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana sylvestris] XP_016500657.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana tabacum] Length = 928 Score = 80.1 bits (196), Expect = 7e-16 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A + CLVLDNW+R W+LLLW AM ALFTWKFLQYR AF V+GYCL T Sbjct: 356 ASCALKCLVLDNWQRGWILLLWLSAMTALFTWKFLQYRQMAAFQVMGYCLAT 407 >XP_019070517.1 PREDICTED: respiratory burst oxidase homolog protein E [Solanum lycopersicum] Length = 946 Score = 80.1 bits (196), Expect = 7e-16 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A +F CLVLDNW+R W+LLLW + M LFTWKFLQYR AF V+GYCL T Sbjct: 374 ASYAFKCLVLDNWQRGWILLLWVMVMAVLFTWKFLQYRQRAAFQVMGYCLAT 425 >XP_015082837.1 PREDICTED: respiratory burst oxidase homolog protein E [Solanum pennellii] XP_015082838.1 PREDICTED: respiratory burst oxidase homolog protein E [Solanum pennellii] Length = 946 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A +F CLVLDNW+R W+LLLW + M LFTWKFLQYR AF V+GYCL T Sbjct: 374 ASYAFKCLVLDNWQRGWILLLWVMIMAVLFTWKFLQYRQRAAFQVMGYCLAT 425 >XP_006353773.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Solanum tuberosum] Length = 940 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A +F CLVLDNW+R W+LLLW + M LFTWKFLQYR AF V+GYCL T Sbjct: 368 ASYAFKCLVLDNWQRGWILLLWVMIMAGLFTWKFLQYRRRAAFQVMGYCLAT 419 >XP_006353772.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Solanum tuberosum] XP_015166948.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Solanum tuberosum] Length = 964 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A +F CLVLDNW+R W+LLLW + M LFTWKFLQYR AF V+GYCL T Sbjct: 368 ASYAFKCLVLDNWQRGWILLLWVMIMAGLFTWKFLQYRRRAAFQVMGYCLAT 419 >XP_016509587.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana tabacum] Length = 744 Score = 78.6 bits (192), Expect = 2e-15 Identities = 34/52 (65%), Positives = 38/52 (73%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A + CLVLDNW+R W+LLLW M ALFTWKFLQYR AF V+GYCL T Sbjct: 359 ASCALKCLVLDNWQRGWILLLWLSVMTALFTWKFLQYRQMAAFQVMGYCLAT 410 >KCW79354.1 hypothetical protein EUGRSUZ_C00773 [Eucalyptus grandis] Length = 925 Score = 78.6 bits (192), Expect = 2e-15 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +1 Query: 73 SSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 SS CLVL+NW+R W+LLLW I M LF WKF+QYR+ AFHV+GYCL T Sbjct: 354 SSLRCLVLENWQRGWILLLWAIVMGCLFAWKFIQYRNMAAFHVMGYCLAT 403 >XP_019245814.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana attenuata] OIT03498.1 respiratory burst oxidase -like protein e [Nicotiana attenuata] Length = 928 Score = 78.6 bits (192), Expect = 2e-15 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 67 AGSSFCCLVLDNWKRMWLLLLWFIAMCALFTWKFLQYRSSPAFHVLGYCLPT 222 A + CLVL+NW+R W+LLLW AM ALFTWKFLQYR AF V+GYCL T Sbjct: 356 ASCALKCLVLENWQRGWILLLWLSAMTALFTWKFLQYRQMAAFQVMGYCLAT 407