BLASTX nr result
ID: Alisma22_contig00040309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040309 (216 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV37850.1 hypothetical protein F511_30760 [Dorcoceras hygrometr... 51 4e-06 XP_012069095.1 PREDICTED: uncharacterized protein LOC105631548 [... 50 6e-06 >KZV37850.1 hypothetical protein F511_30760 [Dorcoceras hygrometricum] Length = 159 Score = 50.8 bits (120), Expect = 4e-06 Identities = 27/66 (40%), Positives = 37/66 (56%) Frame = -3 Query: 205 HISGDAQIPPNAVIDKQF*QAYVQWLKDDSGVRTWMVNSAEPKISHSLLRLQNAKAMWDQ 26 +++GD +PP A D AY WL D+S V W++NS E IS L Q AK +WD Sbjct: 35 YLTGD--LPPPATTDP----AYPTWLADNSIVLAWLINSMETNISRRYLWFQTAKEVWDA 88 Query: 25 LSHVYS 8 + +YS Sbjct: 89 VRRMYS 94 >XP_012069095.1 PREDICTED: uncharacterized protein LOC105631548 [Jatropha curcas] Length = 140 Score = 50.1 bits (118), Expect = 6e-06 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = -3 Query: 205 HISGDAQIPPNAVIDKQF*QAYVQWLKDDSGVRTWMVNSAEPKISHSLLRLQNAKAMWDQ 26 H+ G P + Y+ W D VR+W+ S I+H +LR Q AK WD+ Sbjct: 65 HVDGSIPQPSQTTESGELNLEYLTWFSQDQFVRSWLNCSVSESIAHHILRCQTAKEAWDK 124 Query: 25 LSHVYS 8 L+ +YS Sbjct: 125 LATIYS 130