BLASTX nr result
ID: Alisma22_contig00040273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040273 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY76858.1 Root phototropism protein 3 [Ananas comosus] 58 2e-07 OAY67663.1 Root phototropism protein 3 [Ananas comosus] 58 3e-07 >OAY76858.1 Root phototropism protein 3 [Ananas comosus] Length = 328 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +2 Query: 224 MWEAESEAFGAGGREYGSAAHDRHDGVKTDGFIRRDQSWY 343 MWE+ESE+ G G R S + HDG+KTDGF RRDQSWY Sbjct: 1 MWESESESHGRGDRGMSSLDSNHHDGLKTDGFERRDQSWY 40 >OAY67663.1 Root phototropism protein 3 [Ananas comosus] Length = 722 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +2 Query: 224 MWEAESEAFGAGGREYGSAAHDRHDGVKTDGFIRRDQSWY 343 MWE+ESE+ G G R S + HDG+KTDGF RRDQSWY Sbjct: 1 MWESESESHGRGDRGMSSLDSNHHDGLKTDGFERRDQSWY 40