BLASTX nr result
ID: Alisma22_contig00040226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040226 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012849199.1 PREDICTED: peroxidase 31 [Erythranthe guttata] EY... 53 4e-06 XP_016561495.1 PREDICTED: peroxidase 63 [Capsicum annuum] 52 7e-06 >XP_012849199.1 PREDICTED: peroxidase 31 [Erythranthe guttata] EYU44705.1 hypothetical protein MIMGU_mgv1a009638mg [Erythranthe guttata] Length = 336 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/37 (67%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +3 Query: 138 RSPPL-STAYYAKTCPRAEEIVQHVVTDKQISTPTTA 245 R PPL +T YY K+CPR E+IVQ V T+KQIS+PTTA Sbjct: 28 RQPPLLTTTYYTKSCPRFEQIVQDVTTNKQISSPTTA 64 >XP_016561495.1 PREDICTED: peroxidase 63 [Capsicum annuum] Length = 330 Score = 52.0 bits (123), Expect = 7e-06 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +3 Query: 138 RSPPLSTAYYAKTCPRAEEIVQHVVTDKQISTPTTA 245 R PL+TAYY +TCPR E+I+Q T+KQI++PTTA Sbjct: 24 RHSPLNTAYYRRTCPRFEQIMQETTTNKQITSPTTA 59