BLASTX nr result
ID: Alisma22_contig00039604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00039604 (479 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006602742.1 PREDICTED: cysteine-rich receptor-like protein ki... 72 7e-12 KHN40580.1 Cysteine-rich receptor-like protein kinase 25 [Glycin... 72 8e-12 JAT59495.1 Cysteine-rich receptor-like protein kinase 25, partia... 72 9e-12 XP_008778956.1 PREDICTED: cysteine-rich repeat secretory protein... 62 1e-11 OAO98885.1 CRK25 [Arabidopsis thaliana] 72 1e-11 NP_192429.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 ... 72 1e-11 NP_001329426.1 cysteine-rich RLK (RECEPTOR-like protein kinase) ... 72 1e-11 XP_017695960.1 PREDICTED: putative receptor-like protein kinase ... 62 1e-11 KRH00545.1 hypothetical protein GLYMA_18G219600 [Glycine max] 70 3e-11 KRH00544.1 hypothetical protein GLYMA_18G219600 [Glycine max] 70 3e-11 KRH00543.1 hypothetical protein GLYMA_18G219600 [Glycine max] 70 3e-11 XP_006602744.1 PREDICTED: cysteine-rich receptor-like protein ki... 70 3e-11 XP_018824422.1 PREDICTED: cysteine-rich receptor-like protein ki... 70 6e-11 XP_010089688.1 Cysteine-rich receptor-like protein kinase 29 [Mo... 70 6e-11 XP_018843858.1 PREDICTED: cysteine-rich repeat secretory protein... 68 9e-11 XP_017424659.1 PREDICTED: cysteine-rich repeat secretory protein... 67 1e-10 XP_006352035.1 PREDICTED: cysteine-rich repeat secretory protein... 67 1e-10 XP_009793791.1 PREDICTED: cysteine-rich repeat secretory protein... 67 1e-10 XP_002874837.1 hypothetical protein ARALYDRAFT_911789 [Arabidops... 68 1e-10 KYP64257.1 Cysteine-rich receptor-like protein kinase 29 [Cajanu... 69 1e-10 >XP_006602742.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Glycine max] KRH00546.1 hypothetical protein GLYMA_18G219700 [Glycine max] Length = 903 Score = 72.4 bits (176), Expect = 7e-12 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR+V PSCN RFE+ PFF N Sbjct: 191 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPDCCEGKQGGRVVFPSCNIRFELYPFFRN 250 Query: 162 WTD 154 TD Sbjct: 251 VTD 253 >KHN40580.1 Cysteine-rich receptor-like protein kinase 25 [Glycine soja] Length = 1698 Score = 72.4 bits (176), Expect = 8e-12 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR+V PSCN RFE+ PFF N Sbjct: 1030 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPDCCEGKQGGRVVFPSCNIRFELYPFFRN 1089 Query: 162 WTD 154 TD Sbjct: 1090 VTD 1092 Score = 70.5 bits (171), Expect = 4e-11 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR++ PSCN R+E+ PFF N Sbjct: 157 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPNCCEGKQGGRVLFPSCNIRYELYPFFRN 216 Query: 162 WTD 154 TD Sbjct: 217 VTD 219 >JAT59495.1 Cysteine-rich receptor-like protein kinase 25, partial [Anthurium amnicola] Length = 530 Score = 72.0 bits (175), Expect = 9e-12 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFN 163 VQCTRD+S+DDCN CLT I+ + FP + GGRI+ +CNFR+E+ PFFN Sbjct: 199 VQCTRDLSADDCNSCLTGIVGEMQGRFPRRKGGRILKATCNFRYELYPFFN 249 >XP_008778956.1 PREDICTED: cysteine-rich repeat secretory protein 38-like, partial [Phoenix dactylifera] Length = 277 Score = 61.6 bits (148), Expect(2) = 1e-11 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFN 163 VQCT+D+S C CL +I++ P K GGR+VA SCNFR+E+ FFN Sbjct: 198 VQCTQDLSPSQCQQCLQNILEPRPTQLDGKKGGRVVAASCNFRYEISKFFN 248 Score = 35.0 bits (79), Expect(2) = 1e-11 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 478 WNVNNITTGAWEFSSSLWAGLKVLTKYAIGNDSR-FAVGQMSLSTHVQFSKLY 323 WNV N+T + F + + +T +A+ N +R FA GQM ST F ++Y Sbjct: 144 WNVKNVTDAS-RFDKIVDELMSAITDWAVSNSTRRFATGQMVNSTKAPFPQIY 195 >OAO98885.1 CRK25 [Arabidopsis thaliana] Length = 675 Score = 71.6 bits (174), Expect = 1e-11 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWTDA 151 VQCT D+++ DC CL +I+YLP+ +GGR++APSC+FR+E+ PF+N T A Sbjct: 199 VQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYNETIA 253 >NP_192429.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 [Arabidopsis thaliana] Q9M0X5.1 RecName: Full=Cysteine-rich receptor-like protein kinase 25; Short=Cysteine-rich RLK25; Flags: Precursor CAB81062.1 receptor protein kinase-like protein [Arabidopsis thaliana] AEE82490.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 [Arabidopsis thaliana] Length = 675 Score = 71.6 bits (174), Expect = 1e-11 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWTDA 151 VQCT D+++ DC CL +I+YLP+ +GGR++APSC+FR+E+ PF+N T A Sbjct: 199 VQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYNETIA 253 >NP_001329426.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 [Arabidopsis thaliana] ANM67607.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 [Arabidopsis thaliana] Length = 693 Score = 71.6 bits (174), Expect = 1e-11 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWTDA 151 VQCT D+++ DC CL +I+YLP+ +GGR++APSC+FR+E+ PF+N T A Sbjct: 217 VQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYNETIA 271 >XP_017695960.1 PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix dactylifera] Length = 680 Score = 62.4 bits (150), Expect(2) = 1e-11 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFN 163 VQCTRD+S C CL I+D P K GGR++ PSCNFR+E+ FF+ Sbjct: 198 VQCTRDLSPSQCQQCLQDILDPRPTQLQGKEGGRVLTPSCNFRYEIYKFFD 248 Score = 33.9 bits (76), Expect(2) = 1e-11 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 478 WNVNNITTGAWEFSSSLWAGLKVLTKYAIGNDS-RFAVGQMSLSTHVQFSKLY 323 WNVNN+T + F + + +T +A+ N + RFA G M ST F ++Y Sbjct: 144 WNVNNVTDPS-RFDKIVDELMSAITDWAVSNSTRRFATGLMVNSTKAPFPEIY 195 >KRH00545.1 hypothetical protein GLYMA_18G219600 [Glycine max] Length = 657 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR++ PSCN R+E+ PFF N Sbjct: 191 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPNCCEGKQGGRVLFPSCNIRYELYPFFRN 250 Query: 162 WTD 154 TD Sbjct: 251 VTD 253 >KRH00544.1 hypothetical protein GLYMA_18G219600 [Glycine max] Length = 701 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR++ PSCN R+E+ PFF N Sbjct: 191 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPNCCEGKQGGRVLFPSCNIRYELYPFFRN 250 Query: 162 WTD 154 TD Sbjct: 251 VTD 253 >KRH00543.1 hypothetical protein GLYMA_18G219600 [Glycine max] Length = 861 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR++ PSCN R+E+ PFF N Sbjct: 191 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPNCCEGKQGGRVLFPSCNIRYELYPFFRN 250 Query: 162 WTD 154 TD Sbjct: 251 VTD 253 >XP_006602744.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Glycine max] KRH00542.1 hypothetical protein GLYMA_18G219600 [Glycine max] Length = 905 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -3 Query: 339 NSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFF-N 163 NS + C QCT+D+S +C CLT I+YLP K GGR++ PSCN R+E+ PFF N Sbjct: 191 NSETLYCLAQCTQDLSPQNCTACLTQAIEYLPNCCEGKQGGRVLFPSCNIRYELYPFFRN 250 Query: 162 WTD 154 TD Sbjct: 251 VTD 253 >XP_018824422.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Juglans regia] Length = 648 Score = 69.7 bits (169), Expect = 6e-11 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWT 157 VQCT D+S DDC CL ++ +P+ KIGGR+V PSCN RFE PFFN T Sbjct: 184 VQCTPDLSMDDCEGCLRGAMEAIPQCCNGKIGGRVVRPSCNIRFETNPFFNST 236 >XP_010089688.1 Cysteine-rich receptor-like protein kinase 29 [Morus notabilis] EXB38211.1 Cysteine-rich receptor-like protein kinase 29 [Morus notabilis] Length = 679 Score = 69.7 bits (169), Expect = 6e-11 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWTD 154 VQCT D+S DCN+CL D +P +KIGGR++ +CNFR+E+R F+N TD Sbjct: 201 VQCTPDLSKQDCNNCLDDAFDDIPTCCDNKIGGRVIGTNCNFRYEIRLFYNQTD 254 >XP_018843858.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X1 [Juglans regia] XP_018843859.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X2 [Juglans regia] XP_018843860.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X3 [Juglans regia] XP_018843861.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X4 [Juglans regia] XP_018831448.1 PREDICTED: cysteine-rich repeat secretory protein 38-like [Juglans regia] Length = 242 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 312 QCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFN 163 QCTRD+SS DC CL IID LP+ K GGR+V+ SCNFR+E+ PF N Sbjct: 192 QCTRDLSSTDCFKCLDGIIDELPRCCDGKEGGRVVSGSCNFRYEIYPFVN 241 >XP_017424659.1 PREDICTED: cysteine-rich repeat secretory protein 38-like [Vigna angularis] KOM43978.1 hypothetical protein LR48_Vigan05g158300 [Vigna angularis] BAT92194.1 hypothetical protein VIGAN_07087300 [Vigna angularis var. angularis] Length = 244 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = -3 Query: 351 VHMFNSRSCTCAVQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRP 172 V++ NS + QCTRD+SS+DC CL ID LP K GGR+V+ SCNFR+E+ P Sbjct: 181 VYLENSVTLYGLTQCTRDLSSNDCKKCLDDAIDELPNCCDGKEGGRVVSGSCNFRYEIYP 240 Query: 171 F 169 F Sbjct: 241 F 241 >XP_006352035.1 PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum tuberosum] Length = 244 Score = 67.4 bits (163), Expect = 1e-10 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFN 163 VQCTRD+S+DDC CL II +P K GGR+V SCNFR+E+ PF N Sbjct: 192 VQCTRDLSNDDCKKCLDGIITEIPSCCDGKEGGRVVGGSCNFRYEIYPFVN 242 >XP_009793791.1 PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana sylvestris] Length = 246 Score = 67.4 bits (163), Expect = 1e-10 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFN 163 VQCTRD+SS+DC CL II +P K GGR+V SCNFR+E+ PF N Sbjct: 194 VQCTRDLSSEDCKQCLEGIITEIPSCCDGKEGGRVVGGSCNFRYEIYPFVN 244 >XP_002874837.1 hypothetical protein ARALYDRAFT_911789 [Arabidopsis lyrata subsp. lyrata] EFH51096.1 hypothetical protein ARALYDRAFT_911789 [Arabidopsis lyrata subsp. lyrata] Length = 340 Score = 68.2 bits (165), Expect = 1e-10 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWTDA 151 VQCT D+++ DC CL I++LP+ +GGR++APSC+FR+E+ PF+N T A Sbjct: 201 VQCTPDLTNQDCESCLRQAINWLPRCCDRSVGGRVIAPSCSFRYELYPFYNETIA 255 >KYP64257.1 Cysteine-rich receptor-like protein kinase 29 [Cajanus cajan] Length = 650 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = -3 Query: 315 VQCTRDISSDDCNDCLTSIIDYLPKVFPDKIGGRIVAPSCNFRFEVRPFFNWTDAFD 145 VQCT D+SS DC DCL I +P+ F DK+G ++ PSCN RFE+ PFF+ T D Sbjct: 181 VQCTPDLSSQDCGDCLDWTISEIPRNFKDKVGVVLLKPSCNVRFEIYPFFDHTTILD 237