BLASTX nr result
ID: Alisma22_contig00039444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00039444 (555 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016683515.1 PREDICTED: uncharacterized protein LOC107901867 [... 90 5e-20 XP_012438651.1 PREDICTED: uncharacterized protein LOC105764568 i... 90 1e-19 XP_012465932.1 PREDICTED: zinc finger BED domain-containing prot... 87 7e-19 XP_012465931.1 PREDICTED: zinc finger BED domain-containing prot... 87 9e-19 XP_016752185.1 PREDICTED: zinc finger BED domain-containing prot... 93 1e-18 XP_016668820.1 PREDICTED: zinc finger BED domain-containing prot... 92 2e-18 XP_016740023.1 PREDICTED: zinc finger BED domain-containing prot... 90 4e-18 XP_016740022.1 PREDICTED: zinc finger BED domain-containing prot... 90 4e-18 XP_012438141.1 PREDICTED: zinc finger BED domain-containing prot... 88 4e-18 XP_012475784.1 PREDICTED: zinc finger BED domain-containing prot... 90 4e-18 XP_012453340.1 PREDICTED: uncharacterized protein LOC105775363 [... 87 5e-18 XP_016724356.1 PREDICTED: zinc finger BED domain-containing prot... 88 5e-18 XP_016724353.1 PREDICTED: zinc finger BED domain-containing prot... 88 6e-18 XP_010675028.2 PREDICTED: zinc finger BED domain-containing prot... 90 7e-18 XP_012455636.1 PREDICTED: zinc finger BED domain-containing prot... 90 8e-18 XP_012438650.1 PREDICTED: zinc finger BED domain-containing prot... 90 8e-18 OMO89036.1 hypothetical protein COLO4_19978 [Corchorus olitorius] 84 8e-18 XP_012438649.1 PREDICTED: zinc finger BED domain-containing prot... 90 8e-18 XP_016500294.1 PREDICTED: zinc finger BED domain-containing prot... 85 9e-18 KJB09837.1 hypothetical protein B456_001G170000 [Gossypium raimo... 90 1e-17 >XP_016683515.1 PREDICTED: uncharacterized protein LOC107901867 [Gossypium hirsutum] Length = 120 Score = 90.1 bits (222), Expect = 5e-20 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 44 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSS 93 >XP_012438651.1 PREDICTED: uncharacterized protein LOC105764568 isoform X3 [Gossypium raimondii] Length = 144 Score = 89.7 bits (221), Expect = 1e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKI+QAL+CTQDWIR SS Sbjct: 56 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIIQALVCTQDWIRKSS 105 >XP_012465932.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Gossypium raimondii] Length = 131 Score = 87.4 bits (215), Expect = 7e-19 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGS 148 RD+LA+PISTVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWI+ S Sbjct: 61 RDVLAIPISTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIQKS 109 >XP_012465931.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Gossypium raimondii] Length = 143 Score = 87.4 bits (215), Expect = 9e-19 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGS 148 RD+LA+PISTVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWI+ S Sbjct: 61 RDVLAIPISTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIQKS 109 >XP_016752185.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Gossypium hirsutum] Length = 570 Score = 92.8 bits (229), Expect = 1e-18 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSSI 154 RD+LA+P+STVASESTFSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS+ Sbjct: 476 RDVLAIPVSTVASESTFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRKSSL 526 >XP_016668820.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Gossypium hirsutum] Length = 677 Score = 92.0 bits (227), Expect = 2e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASESTFSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 615 RDVLAIPVSTVASESTFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRKSS 664 >XP_016740023.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Gossypium hirsutum] Length = 345 Score = 90.1 bits (222), Expect = 4e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 263 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSS 312 >XP_016740022.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Gossypium hirsutum] Length = 351 Score = 90.1 bits (222), Expect = 4e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 263 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSS 312 >XP_012438141.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Gossypium raimondii] Length = 243 Score = 88.2 bits (217), Expect = 4e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGG VLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 155 RDVLAIPVSTVASESAFSTGGHVLDQYRSSLTPKIVQALVCTQDWIRRSS 204 >XP_012475784.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Gossypium raimondii] Length = 369 Score = 90.1 bits (222), Expect = 4e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 265 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSS 314 >XP_012453340.1 PREDICTED: uncharacterized protein LOC105775363 [Gossypium raimondii] Length = 184 Score = 86.7 bits (213), Expect = 5e-18 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+L +P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR S Sbjct: 96 RDVLGIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRKPS 145 >XP_016724356.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like isoform X2 [Gossypium hirsutum] Length = 237 Score = 87.8 bits (216), Expect = 5e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+PI T+ASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 155 RDVLAIPIFTIASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRKSS 204 >XP_016724353.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like isoform X1 [Gossypium hirsutum] Length = 243 Score = 87.8 bits (216), Expect = 6e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+PI T+ASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 155 RDVLAIPIFTIASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRKSS 204 >XP_010675028.2 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Beta vulgaris subsp. vulgaris] Length = 443 Score = 90.1 bits (222), Expect = 7e-18 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSSIDI 160 RD+LA+P+STVASES FSTGGRVLD FRSSLTPKIV+AL+C QDW+R S +D+ Sbjct: 364 RDVLAIPVSTVASESAFSTGGRVLDPFRSSLTPKIVEALVCGQDWLRASPVDV 416 >XP_012455636.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Gossypium raimondii] Length = 454 Score = 90.1 bits (222), Expect = 8e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 372 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSS 421 >XP_012438650.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Gossypium raimondii] Length = 401 Score = 89.7 bits (221), Expect = 8e-18 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKI+QAL+CTQDWIR SS Sbjct: 319 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIIQALVCTQDWIRKSS 368 >OMO89036.1 hypothetical protein COLO4_19978 [Corchorus olitorius] Length = 95 Score = 83.6 bits (205), Expect = 8e-18 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGS 148 RD+LAVP+STVASES FSTGGRVLD +RS L PK VQAL+C QDW+RGS Sbjct: 14 RDVLAVPVSTVASESAFSTGGRVLDVYRSCLNPKFVQALVCGQDWLRGS 62 >XP_012438649.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Gossypium raimondii] Length = 407 Score = 89.7 bits (221), Expect = 8e-18 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKI+QAL+CTQDWIR SS Sbjct: 319 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIIQALVCTQDWIRKSS 368 >XP_016500294.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tabacum] Length = 139 Score = 84.7 bits (208), Expect = 9e-18 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSSIDIGV 166 RD+LA+PIS+VASE FSTGGR+LD+FRSSLTPK+VQ+LIC QDW+R I I V Sbjct: 59 RDVLAIPISSVASECAFSTGGRILDSFRSSLTPKLVQSLICLQDWLRSEPIPIKV 113 >KJB09837.1 hypothetical protein B456_001G170000 [Gossypium raimondii] Length = 620 Score = 90.1 bits (222), Expect = 1e-17 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 RDILAVPISTVASESTFSTGGRVLDAFRSSLTPKIVQALICTQDWIRGSS 151 RD+LA+P+STVASES FSTGGRVLD +RSSLTPKIVQAL+CTQDWIR SS Sbjct: 524 RDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSS 573