BLASTX nr result
ID: Alisma22_contig00039180
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00039180 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP40915.1 Retrovirus-related Pol polyprotein from transposon TN... 74 5e-15 KYP50397.1 Retrovirus-related Pol polyprotein from transposon TN... 71 8e-14 ABI34342.1 Polyprotein, putative [Solanum demissum] 73 2e-13 AFN88207.1 integrase core domain containing protein [Phaseolus v... 73 2e-13 KYP52605.1 Retrovirus-related Pol polyprotein from transposon TN... 70 3e-13 KYP42175.1 Retrovirus-related Pol polyprotein from transposon TN... 72 3e-13 KYP75541.1 Retrovirus-related Pol polyprotein from transposon TN... 73 3e-13 XP_016547517.1 PREDICTED: DNA topoisomerase 3-alpha isoform X7 [... 73 3e-13 XP_009778353.1 PREDICTED: uncharacterized protein LOC104227744 [... 73 3e-13 KYP51688.1 Retrovirus-related Pol polyprotein from transposon TN... 69 5e-13 ABI34329.1 Integrase core domain containing protein [Solanum dem... 72 6e-13 KYP46624.1 Retrovirus-related Pol polyprotein from transposon TN... 71 7e-13 KYP48169.1 Retrovirus-related Pol polyprotein from transposon TN... 70 8e-13 CAN63530.1 hypothetical protein VITISV_038849 [Vitis vinifera] 72 9e-13 KYP34729.1 Retrovirus-related Pol polyprotein from transposon TN... 72 9e-13 KYP32657.1 Retrovirus-related Pol polyprotein from transposon TN... 69 1e-12 KYP45103.1 Retrovirus-related Pol polyprotein from transposon TN... 70 2e-12 BAU00227.1 hypothetical protein VIGAN_10180200, partial [Vigna a... 66 2e-12 KYP34536.1 Retrovirus-related Pol polyprotein from transposon TN... 70 2e-12 KYP53389.1 Two pore calcium channel protein 1 [Cajanus cajan] 67 2e-12 >KYP40915.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 152 Score = 74.3 bits (181), Expect = 5e-15 Identities = 38/81 (46%), Positives = 53/81 (65%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K+LI +L NL++L E CQLGKH RS F + +R +F +IH N WG S VTS G++ Sbjct: 29 KLLIPILKNLEELGCESCQLGKHVRSSFPKQTDKRCNSIFTTIHYNIWGPSRVTS-FGFR 87 Query: 63 HFVMFADDYSRAI*LNLMKKY 1 +FV F D++SR + LMK + Sbjct: 88 YFVTFIDEFSRCTWVYLMKDH 108 >KYP50397.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 139 Score = 70.9 bits (172), Expect = 8e-14 Identities = 35/79 (44%), Positives = 49/79 (62%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K ++ LS L+ L+ E CQLGKH R+ F + R V F+ IH + WG S V S LG++ Sbjct: 34 KKMVPHLSRLESLECESCQLGKHVRTSFPKSINSRVVSPFDVIHSDVWGPSRVPSLLGHR 93 Query: 63 HFVMFADDYSRAI*LNLMK 7 ++V F DD+SR + LMK Sbjct: 94 YYVTFIDDFSRCTWIFLMK 112 >ABI34342.1 Polyprotein, putative [Solanum demissum] Length = 1054 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/73 (47%), Positives = 46/73 (63%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS+L L E CQLGKHTR+ F R+ +F +H + WG S V+S LG+++FV F Sbjct: 268 LSSLSTLDCESCQLGKHTRATFSRSTEGRSESIFSLVHSDIWGPSRVSSTLGFRYFVSFI 327 Query: 45 DDYSRAI*LNLMK 7 DDYSR + LMK Sbjct: 328 DDYSRCTWVFLMK 340 >AFN88207.1 integrase core domain containing protein [Phaseolus vulgaris] Length = 1387 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/77 (48%), Positives = 46/77 (59%) Frame = -2 Query: 237 LILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHF 58 L+ LSN+ L E CQ GKH RS F S SQR F +H + WG S + S LG+++F Sbjct: 498 LVPSLSNVSSLSCESCQFGKHIRSSFPSSVSQRASSPFALVHSDIWGPSRIKSNLGFQYF 557 Query: 57 VMFADDYSRAI*LNLMK 7 V F DDYSR + LMK Sbjct: 558 VTFIDDYSRCTWVFLMK 574 >KYP52605.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 160 Score = 70.1 bits (170), Expect = 3e-13 Identities = 34/73 (46%), Positives = 46/73 (63%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS L+ L+ E CQLGKH R+ F + R V F+ IH + WG S V S LG++++V F Sbjct: 5 LSRLESLECESCQLGKHVRTSFPKSINSRVVSPFDVIHSDVWGPSRVPSLLGHRYYVTFI 64 Query: 45 DDYSRAI*LNLMK 7 DD+SR + LMK Sbjct: 65 DDFSRCTWIFLMK 77 >KYP42175.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 304 Score = 72.4 bits (176), Expect = 3e-13 Identities = 35/79 (44%), Positives = 50/79 (63%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K ++ LS L+ L+ E CQLGKH R+ F + R V F+ IH + WG+S V S LGY+ Sbjct: 141 KKMVPHLSRLESLECESCQLGKHVRTSFPKSINSRAVSPFDVIHSDVWGLSRVPSLLGYR 200 Query: 63 HFVMFADDYSRAI*LNLMK 7 ++V F D++SR + LMK Sbjct: 201 YYVTFIDEFSRCTWIFLMK 219 >KYP75541.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 568 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/79 (45%), Positives = 50/79 (63%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K ++ LS L+ L+ E CQLGKH R+ F + + R V F+ IH N WG S V S LG++ Sbjct: 47 KKMVPYLSRLESLKCESCQLGKHVRTSFPNSINNRAVSPFDVIHSNVWGPSRVPSLLGHR 106 Query: 63 HFVMFADDYSRAI*LNLMK 7 ++V F DD+SR + LMK Sbjct: 107 YYVTFIDDFSRFTWIILMK 125 >XP_016547517.1 PREDICTED: DNA topoisomerase 3-alpha isoform X7 [Capsicum annuum] Length = 733 Score = 72.8 bits (177), Expect = 3e-13 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = -2 Query: 237 LILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHF 58 ++L LS L L E CQLGKHTR+ F R+ F+F +H + WG + V S LG+++F Sbjct: 660 MVLSLSGLSTLDCESCQLGKHTRATFSCNIESRSEFIFSLVHSDVWGPNRVDSPLGFRYF 719 Query: 57 VMFADDYSR 31 V F DD+SR Sbjct: 720 VSFIDDFSR 728 >XP_009778353.1 PREDICTED: uncharacterized protein LOC104227744 [Nicotiana sylvestris] Length = 1133 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/73 (49%), Positives = 46/73 (63%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS+L +L+ E CQLGKHTR+ F VF +H + WG S V+S LG+++FV F Sbjct: 653 LSSLYRLECESCQLGKHTRASFTCSVESHAESVFSLVHSDIWGPSRVSSTLGFRYFVSFI 712 Query: 45 DDYSRAI*LNLMK 7 DDYSR L LMK Sbjct: 713 DDYSRCTWLFLMK 725 >KYP51688.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 160 Score = 69.3 bits (168), Expect = 5e-13 Identities = 33/73 (45%), Positives = 47/73 (64%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS L+ L+ E CQLGKH R+ F + + R + F+ IH + WG S V S LG++++V F Sbjct: 5 LSRLESLECESCQLGKHVRASFPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFI 64 Query: 45 DDYSRAI*LNLMK 7 DD+SR + LMK Sbjct: 65 DDFSRCTWIFLMK 77 >ABI34329.1 Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 72.0 bits (175), Expect = 6e-13 Identities = 34/73 (46%), Positives = 46/73 (63%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS+L L E CQLGKHTR+ F R+ +F +H + WG S V+S LG+++FV F Sbjct: 507 LSSLSTLDCESCQLGKHTRATFSRSTEGRSESIFSLVHSDIWGPSRVSSTLGFRYFVSFI 566 Query: 45 DDYSRAI*LNLMK 7 DDYS+ + LMK Sbjct: 567 DDYSKCTWVFLMK 579 >KYP46624.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 263 Score = 70.9 bits (172), Expect = 7e-13 Identities = 37/79 (46%), Positives = 50/79 (63%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K+L+ L L +L E CQLGKH RS F + +R +F SIH + WG SHVTS G++ Sbjct: 3 KLLVPSLQKLAELGCESCQLGKHVRSSFPKQTDKRCNSIFTSIHSDIWGPSHVTS-FGFR 61 Query: 63 HFVMFADDYSRAI*LNLMK 7 +FV F D++SR + LMK Sbjct: 62 YFVTFIDEFSRCTWVYLMK 80 >KYP48169.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 224 Score = 70.1 bits (170), Expect = 8e-13 Identities = 36/79 (45%), Positives = 50/79 (63%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K+L+ L NL++L E CQLGKH R F + R +F +IH + WG SHVTS G++ Sbjct: 125 KLLVPSLKNLEELGCESCQLGKHVRPSFPKQTDTRCNSIFTTIHFDIWGPSHVTS-FGFR 183 Query: 63 HFVMFADDYSRAI*LNLMK 7 +FV F D++SR + LMK Sbjct: 184 YFVTFVDEFSRCTWVYLMK 202 >CAN63530.1 hypothetical protein VITISV_038849 [Vitis vinifera] Length = 938 Score = 71.6 bits (174), Expect = 9e-13 Identities = 37/72 (51%), Positives = 43/72 (59%) Frame = -2 Query: 222 SNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFAD 43 S+L L E CQLGKHTR F + + R FE IH N WG S S LG+++FV F D Sbjct: 349 SSLSSLACESCQLGKHTRVSFPKRLNNRAKSHFELIHTNVWGPSRTASTLGFQYFVTFID 408 Query: 42 DYSRAI*LNLMK 7 DYSR L LMK Sbjct: 409 DYSRCTWLFLMK 420 >KYP34729.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1180 Score = 71.6 bits (174), Expect = 9e-13 Identities = 34/79 (43%), Positives = 51/79 (64%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K ++ LS L+ L+ E CQLGKH R+ F + + R + +F+ IH + WG S V S LG++ Sbjct: 279 KKMVPHLSRLESLECESCQLGKHVRASFPNSVNSRAMCLFDVIHSDVWGPSRVPSLLGHR 338 Query: 63 HFVMFADDYSRAI*LNLMK 7 ++V F DD+SR + LMK Sbjct: 339 YYVTFIDDFSRCTWIFLMK 357 >KYP32657.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 217 Score = 69.3 bits (168), Expect = 1e-12 Identities = 33/73 (45%), Positives = 47/73 (64%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS L+ L+ E CQLGKH R+ F + + R + F+ IH + WG S V S LG++++V F Sbjct: 5 LSRLESLECESCQLGKHVRASFPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFI 64 Query: 45 DDYSRAI*LNLMK 7 DD+SR + LMK Sbjct: 65 DDFSRCTWIFLMK 77 >KYP45103.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 326 Score = 70.5 bits (171), Expect = 2e-12 Identities = 35/79 (44%), Positives = 48/79 (60%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K ++ LS L+ L+ E CQLGKH R+ F R V F+ IH + WG S V S LG++ Sbjct: 205 KKMVPHLSRLESLECESCQLGKHVRTSFPKSIKSRAVSPFDVIHSDVWGPSRVPSLLGHR 264 Query: 63 HFVMFADDYSRAI*LNLMK 7 ++V F DD+SR + LMK Sbjct: 265 YYVTFIDDFSRCTWIFLMK 283 >BAU00227.1 hypothetical protein VIGAN_10180200, partial [Vigna angularis var. angularis] Length = 76 Score = 65.9 bits (159), Expect = 2e-12 Identities = 34/73 (46%), Positives = 43/73 (58%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS L L+ E CQLGKH RSVF + F IH + WG S V+S G+++FV F Sbjct: 5 LSGLQTLECESCQLGKHVRSVFPKRSQSMCTSSFSIIHSDVWGPSRVSS-FGFRYFVTFI 63 Query: 45 DDYSRAI*LNLMK 7 D+YSR + LMK Sbjct: 64 DEYSRCTWVYLMK 76 >KYP34536.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 372 Score = 70.5 bits (171), Expect = 2e-12 Identities = 36/79 (45%), Positives = 51/79 (64%) Frame = -2 Query: 243 KVLILVLSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYK 64 K+L+ L L++L E CQLGKH RS F + +R +F +IH + WG SHVTS G++ Sbjct: 64 KLLVPSLQKLEELGCESCQLGKHVRSSFPKQTDKRCNSIFTTIHSDIWGPSHVTS-FGFR 122 Query: 63 HFVMFADDYSRAI*LNLMK 7 +FV+F D++SR LMK Sbjct: 123 YFVIFIDEFSRCTWEYLMK 141 >KYP53389.1 Two pore calcium channel protein 1 [Cajanus cajan] Length = 144 Score = 67.4 bits (163), Expect = 2e-12 Identities = 31/65 (47%), Positives = 43/65 (66%) Frame = -2 Query: 225 LSNLDKLQFELCQLGKHTRSVFRSKESQRTVFVFESIHPNTWGVSHVTSKLGYKHFVMFA 46 LS+L+ L+ E CQLGKH R+ F + R V F+ IH + WG S V S LG++++V F Sbjct: 5 LSHLESLECESCQLGKHVRTSFPKSINSRAVSPFDVIHSDVWGPSRVPSLLGHRYYVTFI 64 Query: 45 DDYSR 31 DD+SR Sbjct: 65 DDFSR 69