BLASTX nr result
ID: Alisma22_contig00038957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038957 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ58690.1 hypothetical protein ZOSMA_74G00310 [Zostera marina] 58 1e-07 >KMZ58690.1 hypothetical protein ZOSMA_74G00310 [Zostera marina] Length = 533 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +2 Query: 137 IYLYDVYWSRPGKVLDLLRHQGVPGPRRRFPTGNLLDI 250 + LY YW+RP K+L+ LR QG+ GPRRRFPTGNLL++ Sbjct: 41 LQLYKKYWARPEKILEKLRKQGIHGPRRRFPTGNLLEM 78