BLASTX nr result
ID: Alisma22_contig00038789
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038789 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABB46907.1 retrotransposon protein, putative, Ty3-gypsy subclass... 54 5e-06 ABA97045.1 retrotransposon protein, putative, Ty3-gypsy subclass... 54 9e-06 >ABB46907.1 retrotransposon protein, putative, Ty3-gypsy subclass [Oryza sativa Japonica Group] Length = 693 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/34 (61%), Positives = 32/34 (94%) Frame = -2 Query: 104 KEKLISAPMLVLPEPREGYIIFCDASKNELGCVL 3 K++L++APMLVLP+PR+G+ ++CDAS++ LGCVL Sbjct: 505 KKRLVTAPMLVLPDPRKGFQVYCDASRHGLGCVL 538 >ABA97045.1 retrotransposon protein, putative, Ty3-gypsy subclass [Oryza sativa Japonica Group] Length = 1474 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/34 (61%), Positives = 31/34 (91%) Frame = -2 Query: 104 KEKLISAPMLVLPEPREGYIIFCDASKNELGCVL 3 K +LISAP+L+LP+P++G+ ++CDASK+ LGCVL Sbjct: 815 KNRLISAPILILPDPKKGFQVYCDASKHGLGCVL 848