BLASTX nr result
ID: Alisma22_contig00038533
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038533 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAP03954.1 hypothetical protein AXX17_AT3G36890 [Arabidopsis tha... 55 1e-06 >OAP03954.1 hypothetical protein AXX17_AT3G36890 [Arabidopsis thaliana] Length = 370 Score = 55.1 bits (131), Expect = 1e-06 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -1 Query: 214 WILDVD---HTFAQM*RISKSRPLKKCEVELHIANGERVVSSAIGTYKXXXXXXLIIEL* 44 W+LD H + ++ SR L++ +V+L +ANG +V + A+GTY +++EL Sbjct: 59 WVLDTGCGAHICVNVHGLNNSRTLEEGQVDLRVANGAKVSALAVGTYSLSLPSCMVLELK 118 Query: 43 NYYYVPTIYKNMI 5 N YYVP I KN+I Sbjct: 119 NCYYVPAINKNII 131