BLASTX nr result
ID: Alisma22_contig00038297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038297 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL02573.1 hypothetical protein IQ06DRAFT_334208 [Stagonospora s... 87 2e-20 >OAL02573.1 hypothetical protein IQ06DRAFT_334208 [Stagonospora sp. SRC1lsM3a] Length = 64 Score = 87.4 bits (215), Expect = 2e-20 Identities = 42/64 (65%), Positives = 46/64 (71%) Frame = +3 Query: 90 MNDMFSTHNLPANPQSPFTAFRSFGTPDYVIRQTRDTASI*ATPMEGHDCAGLRIIMGCW 269 MNDMFSTHNLPA Q A RSFG P YVI +TRDTAS T +GH+CAGL I +GCW Sbjct: 1 MNDMFSTHNLPARSQLLSAALRSFGLPGYVIWRTRDTASFKITTTDGHECAGLGITIGCW 60 Query: 270 STTR 281 S TR Sbjct: 61 SITR 64