BLASTX nr result
ID: Alisma22_contig00038227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038227 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ66889.1 putative Pentatricopeptide repeat-containing protein ... 95 2e-20 XP_008802748.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 1e-19 XP_010935587.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 3e-18 JAT60253.1 Pentatricopeptide repeat-containing protein At5g38730... 87 6e-18 XP_020113145.1 pentatricopeptide repeat-containing protein At5g3... 82 5e-16 OAY83777.1 Pentatricopeptide repeat-containing protein, partial ... 82 5e-16 XP_010248801.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 8e-15 XP_009398337.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 3e-14 ONK64109.1 uncharacterized protein A4U43_C07F22170 [Asparagus of... 76 5e-14 XP_010675446.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 XP_003627859.1 PPR containing plant-like protein [Medicago trunc... 66 2e-10 XP_012088123.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 4e-10 ERN10234.1 hypothetical protein AMTR_s00171p00059960 [Amborella ... 63 1e-09 OAO96225.1 hypothetical protein AXX17_AT5G36090 [Arabidopsis tha... 64 1e-09 NP_198689.1 Tetratricopeptide repeat (TPR)-like superfamily prot... 64 1e-09 XP_018834142.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_004288209.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_015583131.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_006848652.2 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 63 2e-09 EEF29498.1 pentatricopeptide repeat-containing protein, putative... 63 2e-09 >KMZ66889.1 putative Pentatricopeptide repeat-containing protein [Zostera marina] Length = 593 Score = 94.7 bits (234), Expect = 2e-20 Identities = 52/93 (55%), Positives = 61/93 (65%), Gaps = 7/93 (7%) Frame = +1 Query: 49 ALPEAICATLVKGNWRRLA------EAHISSSVVDHVLTLLRPDD-SLCWSFFKWSLSLP 207 A E ICA L+KGNW RL + ISSS++DHVL LLR +D SL ++FF W+LS P Sbjct: 3 ATAEGICAILIKGNWSRLQIQPQQQQPLISSSIIDHVLVLLRRNDFSLAYTFFTWTLSFP 62 Query: 208 NHTHHSLHSNWNMVHLLIQNGRLSLARQLLETF 306 H + SLHS WNMVHLL RL AR LL TF Sbjct: 63 QHCY-SLHSYWNMVHLLTTANRLQTARSLLHTF 94 >XP_008802748.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Phoenix dactylifera] Length = 589 Score = 92.4 bits (228), Expect = 1e-19 Identities = 48/102 (47%), Positives = 62/102 (60%), Gaps = 4/102 (3%) Frame = +1 Query: 22 SALRRTIAVALPEAICATLVKGNWRRLAEAHIS----SSVVDHVLTLLRPDDSLCWSFFK 189 S + R VA + +CA + KGNW L+ ++S +S V+ +L L D SL W FFK Sbjct: 3 SLIYRKKEVAFIQGVCAIVSKGNWSNLSNTNVSHGFTTSNVNQILLQLSADTSLSWGFFK 62 Query: 190 WSLSLPNHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 W SLP H HHSL NW MVHLL +N + AR+LLE FAF+ Sbjct: 63 WLQSLP-HYHHSLQPNWTMVHLLTKNRQFKAARELLERFAFK 103 >XP_010935587.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Elaeis guineensis] Length = 589 Score = 88.2 bits (217), Expect = 3e-18 Identities = 45/102 (44%), Positives = 62/102 (60%), Gaps = 4/102 (3%) Frame = +1 Query: 22 SALRRTIAVALPEAICATLVKGNWRRLAEAHIS----SSVVDHVLTLLRPDDSLCWSFFK 189 S + R V + +CA ++KG+W L+ HIS +S V+ +L L D L W+FF+ Sbjct: 3 SLVYRKNEVGFIQGVCAIVLKGSWSNLSNTHISHCLTTSNVNQILLQLSADTPLSWAFFR 62 Query: 190 WSLSLPNHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 W SLP + HHSL NW MVHLL +N + AR+LLE FAF+ Sbjct: 63 WMQSLPYY-HHSLQPNWTMVHLLTKNRQFKAARELLEKFAFK 103 >JAT60253.1 Pentatricopeptide repeat-containing protein At5g38730, partial [Anthurium amnicola] Length = 618 Score = 87.4 bits (215), Expect = 6e-18 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 7/96 (7%) Frame = +1 Query: 49 ALPEAICATLVKGNWRRLAEAHISS----SVVDHVLTLLRPDD---SLCWSFFKWSLSLP 207 A +CA ++KGNWR L+ A ++S S V VL LL P SL WSFF+W SLP Sbjct: 37 AFVNGVCAAVLKGNWRHLSRAVVASRFTPSTVTRVLLLLSPHGAGPSLSWSFFRWLQSLP 96 Query: 208 NHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 N+ HHSL SNW M LL Q AR+LLE FAF+ Sbjct: 97 NY-HHSLQSNWAMARLLTQRRHFRTARELLERFAFK 131 >XP_020113145.1 pentatricopeptide repeat-containing protein At5g38730 isoform X1 [Ananas comosus] XP_020113146.1 pentatricopeptide repeat-containing protein At5g38730 isoform X1 [Ananas comosus] Length = 593 Score = 82.0 bits (201), Expect = 5e-16 Identities = 42/90 (46%), Positives = 54/90 (60%), Gaps = 4/90 (4%) Frame = +1 Query: 58 EAICATLVKGNWRRLAEAHISSSV----VDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHS 225 + +CA + KGNW L+ H+++S V +L L D SL W FFKW SLP H +HS Sbjct: 15 QGVCAIVSKGNWSNLSTTHVANSFNTSNVTQILLELSADTSLSWLFFKWVQSLP-HYNHS 73 Query: 226 LHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 L NW MVHLL +N + A QLLE FA + Sbjct: 74 LEPNWTMVHLLAKNRQFKAACQLLEKFAVK 103 >OAY83777.1 Pentatricopeptide repeat-containing protein, partial [Ananas comosus] Length = 607 Score = 82.0 bits (201), Expect = 5e-16 Identities = 42/90 (46%), Positives = 54/90 (60%), Gaps = 4/90 (4%) Frame = +1 Query: 58 EAICATLVKGNWRRLAEAHISSSV----VDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHS 225 + +CA + KGNW L+ H+++S V +L L D SL W FFKW SLP H +HS Sbjct: 15 QGVCAIVSKGNWSNLSTTHVANSFNTSNVTQILLELSADTSLSWLFFKWVQSLP-HYNHS 73 Query: 226 LHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 L NW MVHLL +N + A QLLE FA + Sbjct: 74 LEPNWTMVHLLAKNRQFKAACQLLEKFAVK 103 >XP_010248801.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Nelumbo nucifera] Length = 583 Score = 78.6 bits (192), Expect = 8e-15 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 4/90 (4%) Frame = +1 Query: 58 EAICATLVKGNWRRLAEAHISS----SVVDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHS 225 +++CA L+KGNW L + +S S+V+ +L L D LCW+FFKW SLP H S Sbjct: 15 QSVCAVLMKGNWLNLLKPKMSHCFTPSLVNRILLYLSLDGPLCWAFFKWVESLP-HYKQS 73 Query: 226 LHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 L NW MVH+L + + + A++LL+ AFR Sbjct: 74 LQPNWTMVHILTEQKQYTTAQELLKRIAFR 103 >XP_009398337.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Musa acuminata subsp. malaccensis] Length = 600 Score = 77.0 bits (188), Expect = 3e-14 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 4/93 (4%) Frame = +1 Query: 49 ALPEAICATLVKGNWRRLAEAHIS----SSVVDHVLTLLRPDDSLCWSFFKWSLSLPNHT 216 A + +CA + KGNW L +S +S V +L L D +L W+FFKW+ S+P H Sbjct: 12 AFIQGVCAIVSKGNWCTLWLPRVSDRFTTSNVHQILLQLSADTALSWNFFKWAQSIP-HY 70 Query: 217 HHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 HHSL +N+ MVHLL ++ R AR LL+ FAF+ Sbjct: 71 HHSLPTNFTMVHLLTRSRRFQEARNLLQKFAFK 103 >ONK64109.1 uncharacterized protein A4U43_C07F22170 [Asparagus officinalis] Length = 589 Score = 76.3 bits (186), Expect = 5e-14 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 4/88 (4%) Frame = +1 Query: 58 EAICATLVKGNWRRLAEAHIS----SSVVDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHS 225 + +CA ++KGN L I+ +S V+ ++ L D L W+FFKW SLP H HHS Sbjct: 15 QGVCANVIKGNRTNLLSTQIAHCLTNSAVNQIVIELSKDTDLSWAFFKWIQSLP-HYHHS 73 Query: 226 LHSNWNMVHLLIQNGRLSLARQLLETFA 309 L +W MVHLL ++ + AR+LLE FA Sbjct: 74 LQCSWTMVHLLTRDRKFKTARELLEKFA 101 >XP_010675446.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Beta vulgaris subsp. vulgaris] KMT13089.1 hypothetical protein BVRB_4g086300 [Beta vulgaris subsp. vulgaris] Length = 586 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/90 (34%), Positives = 55/90 (61%), Gaps = 4/90 (4%) Frame = +1 Query: 58 EAICATLVKGNWRRLAE----AHISSSVVDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHS 225 + +CA ++KGNW +L + +H+SS V+ VL+ L D W F++W +P + H S Sbjct: 15 KTLCAIVLKGNWNQLLKPQIGSHLSSVTVEKVLSQLSLDFYNSWVFYEWVEKIPGYKH-S 73 Query: 226 LHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 L NW+M+H+L ++ +A+++LE A + Sbjct: 74 LEFNWSMIHMLTKHNHFRIAQKVLEKIALK 103 >XP_003627859.1 PPR containing plant-like protein [Medicago truncatula] AET02335.1 PPR containing plant-like protein [Medicago truncatula] Length = 731 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/95 (35%), Positives = 60/95 (63%), Gaps = 7/95 (7%) Frame = +1 Query: 52 LPEAICATLVKGNWRRLAE----AHISSSVVDHVLTLL---RPDDSLCWSFFKWSLSLPN 210 L E++CA +VKG+W L + + ++S+ + V+ L R + + FFKW+ S+P+ Sbjct: 14 LIESVCAIIVKGDWNNLLKPKTASTLTSTTIHQVILHLKQHRYEPFFIFHFFKWAQSIPH 73 Query: 211 HTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 +TH SLHS+W+M+H+L ++ A+Q+L+ A R Sbjct: 74 YTH-SLHSSWSMIHMLTKHRHFKTAQQVLDKMAQR 107 >XP_012088123.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Jatropha curcas] Length = 589 Score = 65.1 bits (157), Expect = 4e-10 Identities = 38/96 (39%), Positives = 56/96 (58%), Gaps = 8/96 (8%) Frame = +1 Query: 52 LPEAICATLVKGNWRRLAEAHI----SSSVVDHVL---TLLRPDDSLCWSFFKW-SLSLP 207 L ++ICAT++KG W L I S++ V+ VL +L SL W+FFKW S+P Sbjct: 13 LVQSICATILKGGWNNLLTPKIGSNFSTTTVNEVLLQLSLHTHSPSLSWTFFKWIESSIP 72 Query: 208 NHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 ++ HSL S+W M+H+L Q A+ LLE A++ Sbjct: 73 SY-KHSLQSSWTMLHILTQYKNFKTAQNLLEKLAYK 107 >ERN10234.1 hypothetical protein AMTR_s00171p00059960 [Amborella trichopoda] Length = 261 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 4/88 (4%) Frame = +1 Query: 64 ICATLVKGNWRRLAEAHISS----SVVDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHSLH 231 +C ++KG + L +I+S ++V+ +L+ L D WSFFKW S+PN+ HS+ Sbjct: 17 VCGIILKGQFHVLTRPNITSRFTNTMVNSILSNLSSDSLASWSFFKWVESIPNY-KHSVQ 75 Query: 232 SNWNMVHLLIQNGRLSLARQLLETFAFR 315 W M+H+L +N + ++A+ L++ FR Sbjct: 76 PYWTMIHILTKNKQYNIAQSLVKRIMFR 103 >OAO96225.1 hypothetical protein AXX17_AT5G36090 [Arabidopsis thaliana] Length = 596 Score = 63.5 bits (153), Expect = 1e-09 Identities = 37/113 (32%), Positives = 61/113 (53%), Gaps = 10/113 (8%) Frame = +1 Query: 7 MIGAPSALRRTIAVALPEAICATLVKGNWRRLAEAHISSSVVDHVLTLLRPDD------- 165 M+ SA R + + ++ICAT++KGNW+ + + + S ++ +T + Sbjct: 1 MVNLLSANREAL---IAQSICATVLKGNWKNILKHKVDSGLLKSAITTQVISELSLFSGY 57 Query: 166 ---SLCWSFFKWSLSLPNHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 SL WSFF W+ SLP+ + HSL S+W M+ +L ++ A QLL+ A R Sbjct: 58 GGPSLSWSFFIWTDSLPS-SKHSLQSSWKMILILTKHKHFKTAHQLLDKLAQR 109 >NP_198689.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] Q9FKR3.1 RecName: Full=Pentatricopeptide repeat-containing protein At5g38730 BAB10131.1 unnamed protein product [Arabidopsis thaliana] AED94354.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] Length = 596 Score = 63.5 bits (153), Expect = 1e-09 Identities = 37/113 (32%), Positives = 61/113 (53%), Gaps = 10/113 (8%) Frame = +1 Query: 7 MIGAPSALRRTIAVALPEAICATLVKGNWRRLAEAHISSSVVDHVLTLLRPDD------- 165 M+ SA R + + ++ICAT++KGNW+ + + + S ++ +T + Sbjct: 1 MVNLLSANREAL---IAQSICATVLKGNWKNILKHKVDSGLLKSAITTQVISELSLFSGY 57 Query: 166 ---SLCWSFFKWSLSLPNHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 SL WSFF W+ SLP+ + HSL S+W M+ +L ++ A QLL+ A R Sbjct: 58 GGPSLSWSFFIWTDSLPS-SKHSLQSSWKMILILTKHKHFKTAHQLLDKLAQR 109 >XP_018834142.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Juglans regia] Length = 588 Score = 63.2 bits (152), Expect = 2e-09 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 8/94 (8%) Frame = +1 Query: 52 LPEAICATLVKGNWRRLAEAHISSSVVDHV-------LTLLRPDDSL-CWSFFKWSLSLP 207 L +AICA +VKG W L + ISS++ L+L SL W+FFKW S+P Sbjct: 13 LVQAICAIVVKGYWNNLLKPKISSTLTSTTTHQVLLQLSLYSYGPSLPSWAFFKWVESVP 72 Query: 208 NHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFA 309 N+ H SL +W M+H+L ++ A+ LLE A Sbjct: 73 NYKH-SLQCSWTMIHILTKHKHFKTAQDLLEKIA 105 >XP_004288209.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Fragaria vesca subsp. vesca] Length = 589 Score = 63.2 bits (152), Expect = 2e-09 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 7/100 (7%) Frame = +1 Query: 37 TIAVALPEAICATLVKGNWRRLAEAHI----SSSVVDHVL---TLLRPDDSLCWSFFKWS 195 T+ L +++ A ++KG+W L + +SS + VL +L SL SFFKW+ Sbjct: 8 TVETQLIQSLFAIVLKGHWSHLLNPKLGSCLTSSAIHQVLLQLSLYGYTPSLSLSFFKWA 67 Query: 196 LSLPNHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 SLPN+ H SL +W MVH+L ++ A Q LE AFR Sbjct: 68 ESLPNYKH-SLQCSWTMVHILTKHRHFKTAHQFLEKIAFR 106 >XP_015583131.1 PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Ricinus communis] Length = 590 Score = 63.2 bits (152), Expect = 2e-09 Identities = 37/96 (38%), Positives = 52/96 (54%), Gaps = 8/96 (8%) Frame = +1 Query: 52 LPEAICATLVKGNWRRLAEAHISSSV-------VDHVLTLLRPDDSLCWSFFKW-SLSLP 207 L + ICAT++KG W L I S + V + L+L L W+ FKW S+P Sbjct: 13 LVQNICATVIKGGWNNLLRPKICSILTASTLHQVLYQLSLHSQGPCLSWALFKWIESSIP 72 Query: 208 NHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 N+ H SL S+W M+H+L + L A+ LLE A+R Sbjct: 73 NYKH-SLQSSWTMIHILTKFKHLKTAQSLLEKIAYR 107 >XP_006848652.2 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g38730 [Amborella trichopoda] Length = 595 Score = 63.2 bits (152), Expect = 2e-09 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 4/88 (4%) Frame = +1 Query: 64 ICATLVKGNWRRLAEAHISS----SVVDHVLTLLRPDDSLCWSFFKWSLSLPNHTHHSLH 231 +C ++KG + L +I+S ++V+ +L+ L D WSFFKW S+PN+ HS+ Sbjct: 17 VCGIILKGQFHVLTRPNITSRFTNTMVNSILSNLSSDSLASWSFFKWVESIPNY-KHSVQ 75 Query: 232 SNWNMVHLLIQNGRLSLARQLLETFAFR 315 W M+H+L +N + ++A+ L++ FR Sbjct: 76 PYWTMIHILTKNKQYNIAQSLVKRIMFR 103 >EEF29498.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 63.2 bits (152), Expect = 2e-09 Identities = 37/96 (38%), Positives = 52/96 (54%), Gaps = 8/96 (8%) Frame = +1 Query: 52 LPEAICATLVKGNWRRLAEAHISSSV-------VDHVLTLLRPDDSLCWSFFKW-SLSLP 207 L + ICAT++KG W L I S + V + L+L L W+ FKW S+P Sbjct: 13 LVQNICATVIKGGWNNLLRPKICSILTASTLHQVLYQLSLHSQGPCLSWALFKWIESSIP 72 Query: 208 NHTHHSLHSNWNMVHLLIQNGRLSLARQLLETFAFR 315 N+ H SL S+W M+H+L + L A+ LLE A+R Sbjct: 73 NYKH-SLQSSWTMIHILTKFKHLKTAQSLLEKIAYR 107