BLASTX nr result
ID: Alisma22_contig00038217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038217 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010257842.1 PREDICTED: small subunit processome component 20 ... 57 3e-07 OAY28297.1 hypothetical protein MANES_15G056200 [Manihot esculenta] 56 1e-06 OAY28298.1 hypothetical protein MANES_15G056200 [Manihot esculenta] 56 1e-06 CAN75046.1 hypothetical protein VITISV_023142 [Vitis vinifera] 55 2e-06 KMZ64468.1 Small subunit processome component-like protein [Zost... 55 2e-06 CBI17281.3 unnamed protein product, partial [Vitis vinifera] 55 2e-06 XP_010650327.1 PREDICTED: small subunit processome component 20 ... 55 2e-06 >XP_010257842.1 PREDICTED: small subunit processome component 20 homolog [Nelumbo nucifera] Length = 2710 Score = 57.4 bits (137), Expect = 3e-07 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 1/100 (1%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDDTS-KVVNKILLLMSSLLNVPSIYEDISILNNIA 228 DY+P+L++V +L+ Y++PS N + +D S +VNKIL M LL+ D S + +I+ Sbjct: 347 DYQPMLNLVGLLMRTYIKPSGNGMVEDHSYDLVNKILQFMLCLLDGLHNSNDASAIASIS 406 Query: 229 DQWAPVFMXXXXXXXXXXXXXXXXXXXXXXAFRGYVMSAL 348 QWAP+F FR +++SAL Sbjct: 407 SQWAPIFELRNPCLLNFIKELLGKDPSLAYVFRSHILSAL 446 >OAY28297.1 hypothetical protein MANES_15G056200 [Manihot esculenta] Length = 2701 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/66 (39%), Positives = 44/66 (66%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDDTSKVVNKILLLMSSLLNVPSIYEDISILNNIAD 231 DY+P+++ V L+ K++ PS+ V +D S++V+KIL LM +L+ D+S +++ Sbjct: 324 DYQPMIECVRSLVQKFIVPSSIVVGEDNSEIVDKILQLMLCILDGLKSSNDMSSISSCLL 383 Query: 232 QWAPVF 249 QWAPVF Sbjct: 384 QWAPVF 389 >OAY28298.1 hypothetical protein MANES_15G056200 [Manihot esculenta] Length = 2707 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/66 (39%), Positives = 44/66 (66%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDDTSKVVNKILLLMSSLLNVPSIYEDISILNNIAD 231 DY+P+++ V L+ K++ PS+ V +D S++V+KIL LM +L+ D+S +++ Sbjct: 330 DYQPMIECVRSLVQKFIVPSSIVVGEDNSEIVDKILQLMLCILDGLKSSNDMSSISSCLL 389 Query: 232 QWAPVF 249 QWAPVF Sbjct: 390 QWAPVF 395 >CAN75046.1 hypothetical protein VITISV_023142 [Vitis vinifera] Length = 2461 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/67 (37%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDD-TSKVVNKILLLMSSLLNVPSIYEDISILNNIA 228 DY+P+L++V +L+ ++ PS V++D S++V+K+L LM +L+ I D+S +++++ Sbjct: 119 DYQPMLELVRLLVRTFIIPSNIVVAEDHLSEIVDKVLQLMLCILDGLHISNDMSTISSLS 178 Query: 229 DQWAPVF 249 QWAP F Sbjct: 179 SQWAPAF 185 >KMZ64468.1 Small subunit processome component-like protein [Zostera marina] Length = 2618 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/67 (38%), Positives = 45/67 (67%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDDTSKVVNKILLLMSSLLNVPSIYEDISILNNIAD 231 DY+P L+ V LI +Y+ S++ +++ S +V++ L LM +LL+V I + S+++ I Sbjct: 339 DYKPFLEGVKTLIERYIPLSSSSETEEQSVIVDRTLKLMLNLLDVRCISSNKSVMSTILV 398 Query: 232 QWAPVFM 252 QWAP+FM Sbjct: 399 QWAPIFM 405 >CBI17281.3 unnamed protein product, partial [Vitis vinifera] Length = 2629 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/67 (37%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDD-TSKVVNKILLLMSSLLNVPSIYEDISILNNIA 228 DY+P+L++V +L+ ++ PS V++D S++V+K+L LM +L+ I D+S +++++ Sbjct: 348 DYQPMLELVRLLVRTFIIPSNIVVAEDHLSEIVDKVLQLMLCILDGLHISNDMSTISSLS 407 Query: 229 DQWAPVF 249 QWAP F Sbjct: 408 SQWAPAF 414 >XP_010650327.1 PREDICTED: small subunit processome component 20 homolog [Vitis vinifera] Length = 2710 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/67 (37%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +1 Query: 52 DYRPILDIVNMLINKYVRPSTNKVSDD-TSKVVNKILLLMSSLLNVPSIYEDISILNNIA 228 DY+P+L++V +L+ ++ PS V++D S++V+K+L LM +L+ I D+S +++++ Sbjct: 348 DYQPMLELVRLLVRTFIIPSNIVVAEDHLSEIVDKVLQLMLCILDGLHISNDMSTISSLS 407 Query: 229 DQWAPVF 249 QWAP F Sbjct: 408 SQWAPAF 414