BLASTX nr result
ID: Alisma22_contig00038097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00038097 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY73443.1 Auxin response factor 2 [Ananas comosus] 70 4e-12 XP_020090490.1 auxin response factor 4-like [Ananas comosus] 70 1e-11 XP_016437492.1 PREDICTED: auxin response factor 2, partial [Nico... 67 2e-11 XP_019171679.1 PREDICTED: auxin response factor 1-like [Ipomoea ... 69 2e-11 KQL08438.1 hypothetical protein SETIT_000340mg [Setaria italica] 69 2e-11 KQL08436.1 hypothetical protein SETIT_000340mg [Setaria italica] 69 2e-11 KQL08437.1 hypothetical protein SETIT_000340mg [Setaria italica] 69 2e-11 XP_004971148.1 PREDICTED: auxin response factor 4-like isoform X... 69 2e-11 XP_004971147.1 PREDICTED: auxin response factor 4-like isoform X... 69 2e-11 ONM34910.1 Auxin response factor 10 [Zea mays] 69 3e-11 XP_002456888.1 hypothetical protein SORBIDRAFT_03g044630 [Sorghu... 69 3e-11 AQK98376.1 Auxin response factor 2 [Zea mays] 69 3e-11 ONM34913.1 Auxin response factor 10 [Zea mays] 69 3e-11 ADG43144.1 auxin response factor 10 [Zea mays] 69 3e-11 ADG43159.1 auxin response factor 25 [Zea mays] 69 3e-11 NP_001307056.1 uncharacterized protein LOC100274571 [Zea mays] O... 69 3e-11 ACN34502.1 unknown [Zea mays] AIB04306.1 ARF transcription facto... 69 3e-11 KXG34038.1 hypothetical protein SORBI_003G411900 [Sorghum bicolor] 69 3e-11 ONM34912.1 Auxin response factor 10 [Zea mays] 69 3e-11 XP_008791040.1 PREDICTED: auxin response factor 23-like isoform ... 69 3e-11 >OAY73443.1 Auxin response factor 2 [Ananas comosus] Length = 230 Score = 69.7 bits (169), Expect = 4e-12 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 240 NDPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 +D LYTE WLACAGPLVT+PR+G+ VFYFPQGHIEQ Sbjct: 31 DDALYTELWLACAGPLVTLPRQGELVFYFPQGHIEQ 66 >XP_020090490.1 auxin response factor 4-like [Ananas comosus] Length = 810 Score = 69.7 bits (169), Expect = 1e-11 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 240 NDPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 +D LYTE WLACAGPLVT+PR+G+ VFYFPQGHIEQ Sbjct: 15 DDALYTELWLACAGPLVTLPRQGELVFYFPQGHIEQ 50 >XP_016437492.1 PREDICTED: auxin response factor 2, partial [Nicotiana tabacum] Length = 200 Score = 67.4 bits (163), Expect = 2e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 249 LYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 LYTE W ACAGPLVTVPREG+ VFYFPQGHIEQ Sbjct: 6 LYTELWRACAGPLVTVPREGELVFYFPQGHIEQ 38 >XP_019171679.1 PREDICTED: auxin response factor 1-like [Ipomoea nil] Length = 658 Score = 69.3 bits (168), Expect = 2e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 240 NDPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 NDPLY E W ACAGPLVTVPREG+ V+YFPQGH+EQ Sbjct: 20 NDPLYKELWHACAGPLVTVPREGERVYYFPQGHMEQ 55 >KQL08438.1 hypothetical protein SETIT_000340mg [Setaria italica] Length = 723 Score = 69.3 bits (168), Expect = 2e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 20 DPLYPELWRACAGPLVTVPRPGDLVFYFPQGHIEQ 54 >KQL08436.1 hypothetical protein SETIT_000340mg [Setaria italica] Length = 724 Score = 69.3 bits (168), Expect = 2e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 20 DPLYPELWRACAGPLVTVPRPGDLVFYFPQGHIEQ 54 >KQL08437.1 hypothetical protein SETIT_000340mg [Setaria italica] Length = 754 Score = 69.3 bits (168), Expect = 2e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 20 DPLYPELWRACAGPLVTVPRPGDLVFYFPQGHIEQ 54 >XP_004971148.1 PREDICTED: auxin response factor 4-like isoform X2 [Setaria italica] Length = 808 Score = 69.3 bits (168), Expect = 2e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 20 DPLYPELWRACAGPLVTVPRPGDLVFYFPQGHIEQ 54 >XP_004971147.1 PREDICTED: auxin response factor 4-like isoform X1 [Setaria italica] KQL08439.1 hypothetical protein SETIT_000340mg [Setaria italica] Length = 809 Score = 69.3 bits (168), Expect = 2e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 20 DPLYPELWRACAGPLVTVPRPGDLVFYFPQGHIEQ 54 >ONM34910.1 Auxin response factor 10 [Zea mays] Length = 459 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 19 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 53 >XP_002456888.1 hypothetical protein SORBIDRAFT_03g044630 [Sorghum bicolor] EES02008.1 hypothetical protein SORBI_003G411900 [Sorghum bicolor] Length = 704 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 19 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 53 >AQK98376.1 Auxin response factor 2 [Zea mays] Length = 721 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 18 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 52 >ONM34913.1 Auxin response factor 10 [Zea mays] Length = 747 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 19 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 53 >ADG43144.1 auxin response factor 10 [Zea mays] Length = 799 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 13 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 47 >ADG43159.1 auxin response factor 25 [Zea mays] Length = 801 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 13 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 47 >NP_001307056.1 uncharacterized protein LOC100274571 [Zea mays] ONM34911.1 Auxin response factor 10 [Zea mays] Length = 805 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 19 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 53 >ACN34502.1 unknown [Zea mays] AIB04306.1 ARF transcription factor, partial [Zea mays] AQK98377.1 Auxin response factor 2 [Zea mays] AQK98379.1 Auxin response factor 2 [Zea mays] AQK98382.1 Auxin response factor 2 [Zea mays] AQK98384.1 Auxin response factor 2 [Zea mays] Length = 806 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 18 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 52 >KXG34038.1 hypothetical protein SORBI_003G411900 [Sorghum bicolor] Length = 810 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 19 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 53 >ONM34912.1 Auxin response factor 10 [Zea mays] Length = 818 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 DPLY E W ACAGPLVTVPR GD VFYFPQGHIEQ Sbjct: 19 DPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQ 53 >XP_008791040.1 PREDICTED: auxin response factor 23-like isoform X2 [Phoenix dactylifera] Length = 859 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 243 DPLYTEFWLACAGPLVTVPREGDWVFYFPQGHIEQ 347 D LYTE WLACAGPLVTVPR G+ VFYFPQGHIEQ Sbjct: 51 DALYTELWLACAGPLVTVPRAGERVFYFPQGHIEQ 85