BLASTX nr result
ID: Alisma22_contig00037976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00037976 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010925866.1 PREDICTED: rho guanine nucleotide exchange factor... 56 4e-06 >XP_010925866.1 PREDICTED: rho guanine nucleotide exchange factor 8-like [Elaeis guineensis] Length = 540 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +3 Query: 378 MDGQPSGWAVDRH-ERVPK*RLGKDGATVAGGKDPVHSDMELMKERFAKLLL 530 +DGQ GWA+DR PK RLGK GG+D + SDMELMKERFAKLLL Sbjct: 57 IDGQQIGWALDRSPSNAPKSRLGK------GGRDGMPSDMELMKERFAKLLL 102