BLASTX nr result
ID: Alisma22_contig00037455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00037455 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004291931.1 PREDICTED: B3 domain-containing protein Os11g0197... 67 1e-10 ERN12682.1 hypothetical protein AMTR_s00025p00247140 [Amborella ... 65 2e-10 JAT58113.1 B3 domain-containing protein Os11g0197600 [Anthurium ... 66 2e-10 ONI32822.1 hypothetical protein PRUPE_1G388200 [Prunus persica] 66 3e-10 XP_008220724.1 PREDICTED: B3 domain-containing protein Os01g0723... 66 4e-10 XP_007221817.1 hypothetical protein PRUPE_ppa003541mg [Prunus pe... 66 4e-10 XP_010683984.1 PREDICTED: B3 domain-containing protein Os01g0723... 65 5e-10 XP_010683976.1 PREDICTED: B3 domain-containing protein Os01g0723... 65 5e-10 XP_020182314.1 myb-like protein X [Aegilops tauschii subsp. taus... 64 1e-09 XP_011625388.1 PREDICTED: B3 domain-containing protein REM16-lik... 64 1e-09 XP_009364120.1 PREDICTED: B3 domain-containing protein Os01g0723... 64 2e-09 XP_018732272.1 PREDICTED: B3 domain-containing protein Os03g0212... 63 2e-09 XP_010089923.1 B3 domain-containing protein [Morus notabilis] EX... 64 2e-09 JAT58779.1 B3 domain-containing protein Os11g0197600 [Anthurium ... 63 4e-09 KNA05666.1 hypothetical protein SOVF_188220, partial [Spinacia o... 61 5e-09 XP_010924483.1 PREDICTED: B3 domain-containing protein Os11g0197... 62 5e-09 XP_010924476.1 PREDICTED: B3 domain-containing protein Os11g0197... 62 6e-09 XP_010924468.1 PREDICTED: B3 domain-containing protein Os11g0197... 62 6e-09 XP_010924459.1 PREDICTED: B3 domain-containing protein Os11g0197... 62 6e-09 XP_010924451.1 PREDICTED: B3 domain-containing protein Os11g0197... 62 6e-09 >XP_004291931.1 PREDICTED: B3 domain-containing protein Os11g0197600-like [Fragaria vesca subsp. vesca] Length = 517 Score = 67.0 bits (162), Expect = 1e-10 Identities = 27/61 (44%), Positives = 39/61 (63%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 NVW V ++E +G F WPAFV+DH L G+FL+F +DG + V + D + C+K +A Sbjct: 57 NVWNVHLIEQNGDLFFHYGWPAFVRDHSLECGDFLIFRYDGELHFTVQVFDQTACEKEAA 116 Query: 133 F 131 F Sbjct: 117 F 117 >ERN12682.1 hypothetical protein AMTR_s00025p00247140 [Amborella trichopoda] Length = 226 Score = 65.5 bits (158), Expect = 2e-10 Identities = 30/61 (49%), Positives = 38/61 (62%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N W VEV EV GA CF W FVKDH L G+FLVF +DG T + + I + + C++ A Sbjct: 56 NNWNVEVEEVRGALCFSRGWKKFVKDHSLNDGDFLVFYYDGDTHFLIKIFNKTGCEREDA 115 Query: 133 F 131 F Sbjct: 116 F 116 >JAT58113.1 B3 domain-containing protein Os11g0197600 [Anthurium amnicola] Length = 310 Score = 66.2 bits (160), Expect = 2e-10 Identities = 28/61 (45%), Positives = 41/61 (67%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N+W+V +++ + FR W FV+DH L+ GEFLVFE+ G + + V+I D SMC+K A Sbjct: 57 NIWRVGMIKNEKGVFFRDGWEEFVRDHSLQTGEFLVFEYQGGSRFRVLIFDASMCEKEDA 116 Query: 133 F 131 F Sbjct: 117 F 117 >ONI32822.1 hypothetical protein PRUPE_1G388200 [Prunus persica] Length = 423 Score = 65.9 bits (159), Expect = 3e-10 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N W V++++ +G F WPAFV+DH + G+FL+F +DG + V+I D S C+K +A Sbjct: 56 NAWNVDLIQKNGDLFFHHGWPAFVRDHFVECGDFLIFRYDGELCFTVLIFDQSACEKEAA 115 Query: 133 F 131 F Sbjct: 116 F 116 >XP_008220724.1 PREDICTED: B3 domain-containing protein Os01g0723500-like [Prunus mume] Length = 567 Score = 65.9 bits (159), Expect = 4e-10 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N W V++++ +G F WPAFV+DH + G+FL+F +DG + V+I D S C+K +A Sbjct: 56 NAWNVDLIQKNGDLFFHHGWPAFVRDHFVECGDFLIFRYDGELCFTVLIFDQSACEKEAA 115 Query: 133 F 131 F Sbjct: 116 F 116 >XP_007221817.1 hypothetical protein PRUPE_ppa003541mg [Prunus persica] ONI32821.1 hypothetical protein PRUPE_1G388200 [Prunus persica] Length = 567 Score = 65.9 bits (159), Expect = 4e-10 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N W V++++ +G F WPAFV+DH + G+FL+F +DG + V+I D S C+K +A Sbjct: 56 NAWNVDLIQKNGDLFFHHGWPAFVRDHFVECGDFLIFRYDGELCFTVLIFDQSACEKEAA 115 Query: 133 F 131 F Sbjct: 116 F 116 >XP_010683984.1 PREDICTED: B3 domain-containing protein Os01g0723500 isoform X2 [Beta vulgaris subsp. vulgaris] KMT19279.1 hypothetical protein BVRB_1g012860 isoform B [Beta vulgaris subsp. vulgaris] Length = 632 Score = 65.5 bits (158), Expect = 5e-10 Identities = 29/66 (43%), Positives = 41/66 (62%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N+W V + E +G F+ W FVKDH + G+ LVFE+DG +++ V I D S C+K A Sbjct: 48 NIWHVNLFEYNGHLFFQDGWSTFVKDHSIECGDSLVFEYDGDSNFTVQIFDQSSCEKDEA 107 Query: 133 FLASPT 116 F A+ T Sbjct: 108 FYANCT 113 >XP_010683976.1 PREDICTED: B3 domain-containing protein Os01g0723500 isoform X1 [Beta vulgaris subsp. vulgaris] KMT19278.1 hypothetical protein BVRB_1g012860 isoform A [Beta vulgaris subsp. vulgaris] Length = 638 Score = 65.5 bits (158), Expect = 5e-10 Identities = 29/66 (43%), Positives = 41/66 (62%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N+W V + E +G F+ W FVKDH + G+ LVFE+DG +++ V I D S C+K A Sbjct: 48 NIWHVNLFEYNGHLFFQDGWSTFVKDHSIECGDSLVFEYDGDSNFTVQIFDQSSCEKDEA 107 Query: 133 FLASPT 116 F A+ T Sbjct: 108 FYANCT 113 >XP_020182314.1 myb-like protein X [Aegilops tauschii subsp. tauschii] Length = 1216 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 1/85 (1%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N+W VE+ ++ G CF W F+ DH + G LVF +DG + + V + S C+ P A Sbjct: 672 NLWPVELAKISGELCFARGWKEFLCDHCIVYGYLLVFRYDGNSQFSVTVFSPSSCEAPYA 731 Query: 133 FLASP-TIXXXXXXXXXVNGHSGVD 62 FLA P + NGH+G + Sbjct: 732 FLAQPQRMGATAVAANDENGHTGTN 756 >XP_011625388.1 PREDICTED: B3 domain-containing protein REM16-like [Amborella trichopoda] Length = 279 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/61 (47%), Positives = 36/61 (59%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N W VEV EV A CF W FV+DH L G+FLVF +DG T + + I D C++ A Sbjct: 72 NCWNVEVEEVGDALCFSRGWKKFVEDHSLNDGDFLVFYYDGDTHFLINIFDEIACERDDA 131 Query: 133 F 131 F Sbjct: 132 F 132 >XP_009364120.1 PREDICTED: B3 domain-containing protein Os01g0723500-like [Pyrus x bretschneideri] Length = 561 Score = 63.9 bits (154), Expect = 2e-09 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 + W VE++E +G WPAFV+DH + G+FL+F +DG + V+I D S C+K +A Sbjct: 52 SAWSVELIEQNGGLFLHHGWPAFVRDHYVECGDFLIFRYDGDLRFTVLIFDQSACEKEAA 111 Query: 133 F 131 F Sbjct: 112 F 112 >XP_018732272.1 PREDICTED: B3 domain-containing protein Os03g0212300-like [Eucalyptus grandis] Length = 248 Score = 62.8 bits (151), Expect = 2e-09 Identities = 25/61 (40%), Positives = 40/61 (65%) Frame = -2 Query: 307 WKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSAFL 128 W V ++E +GA F G WP FV+DH ++ G+FLVF +DG ++V + D +M + ++F Sbjct: 51 WMVGLIEEEGALYFGGGWPKFVEDHSVQTGDFLVFRYDGEDGFEVQVFDPTMSPREASFF 110 Query: 127 A 125 A Sbjct: 111 A 111 >XP_010089923.1 B3 domain-containing protein [Morus notabilis] EXB38619.1 B3 domain-containing protein [Morus notabilis] Length = 623 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/63 (41%), Positives = 41/63 (65%) Frame = -2 Query: 313 NVWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSA 134 N W+V++V+ +G WPAFV+DH + G+FL+F +DG + V + D S C+K +A Sbjct: 56 NTWQVDLVQQNGDLFLHYGWPAFVRDHFVECGDFLIFRYDGDLHFTVQVFDQSACEKEAA 115 Query: 133 FLA 125 FL+ Sbjct: 116 FLS 118 >JAT58779.1 B3 domain-containing protein Os11g0197600 [Anthurium amnicola] Length = 419 Score = 62.8 bits (151), Expect = 4e-09 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = -2 Query: 313 NVWKVEV-VEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPS 137 NVW V + + DG F W FV DH LR G+FLVF +DG S+ VVI D + C++ Sbjct: 74 NVWNVHLAMNKDGGMAFWNGWEDFVLDHSLRAGDFLVFRYDGGPSFTVVIFDPTACEREE 133 Query: 136 AFLASPT 116 AF P+ Sbjct: 134 AFHVMPS 140 >KNA05666.1 hypothetical protein SOVF_188220, partial [Spinacia oleracea] Length = 188 Score = 60.8 bits (146), Expect = 5e-09 Identities = 26/58 (44%), Positives = 39/58 (67%) Frame = -2 Query: 310 VWKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPS 137 +W + VV +DG F GAW FV D+ L GEF+VF+++G+ ++DV+IL C+K S Sbjct: 43 IWLINVVRIDGRLHFEGAWSKFVLDNSLSFGEFMVFKYNGQRTFDVLILGRDGCEKES 100 >XP_010924483.1 PREDICTED: B3 domain-containing protein Os11g0197600 isoform X7 [Elaeis guineensis] XP_019703814.1 PREDICTED: B3 domain-containing protein Os11g0197600 isoform X7 [Elaeis guineensis] Length = 389 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 307 WKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSAFL 128 W VE V+ F W FV DH + G+FLVF +DG + V++LD + C+K +AFL Sbjct: 49 WNVEFVKSSKGLLFANGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFL 108 Query: 127 ASP 119 A P Sbjct: 109 ARP 111 >XP_010924476.1 PREDICTED: B3 domain-containing protein Os11g0197600 isoform X6 [Elaeis guineensis] Length = 411 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 307 WKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSAFL 128 W VE V+ F W FV DH + G+FLVF +DG + V++LD + C+K +AFL Sbjct: 49 WNVEFVKSSKGLLFANGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFL 108 Query: 127 ASP 119 A P Sbjct: 109 ARP 111 >XP_010924468.1 PREDICTED: B3 domain-containing protein Os11g0197600 isoform X5 [Elaeis guineensis] Length = 451 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 307 WKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSAFL 128 W VE V+ F W FV DH + G+FLVF +DG + V++LD + C+K +AFL Sbjct: 49 WNVEFVKSSKGLLFANGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFL 108 Query: 127 ASP 119 A P Sbjct: 109 ARP 111 >XP_010924459.1 PREDICTED: B3 domain-containing protein Os11g0197600 isoform X4 [Elaeis guineensis] Length = 454 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 307 WKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSAFL 128 W VE V+ F W FV DH + G+FLVF +DG + V++LD + C+K +AFL Sbjct: 49 WNVEFVKSSKGLLFANGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFL 108 Query: 127 ASP 119 A P Sbjct: 109 ARP 111 >XP_010924451.1 PREDICTED: B3 domain-containing protein Os11g0197600 isoform X3 [Elaeis guineensis] Length = 455 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/63 (42%), Positives = 37/63 (58%) Frame = -2 Query: 307 WKVEVVEVDGARCFRGAWPAFVKDHGLRPGEFLVFEWDGRTSYDVVILDYSMCDKPSAFL 128 W VE V+ F W FV DH + G+FLVF +DG + V++LD + C+K +AFL Sbjct: 49 WNVEFVKSSKGLLFANGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFL 108 Query: 127 ASP 119 A P Sbjct: 109 ARP 111