BLASTX nr result
ID: Alisma22_contig00037368
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00037368 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010938627.1 PREDICTED: probable calcium-binding protein CML10... 47 4e-06 >XP_010938627.1 PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis] XP_010938628.1 PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis] Length = 189 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 23/36 (63%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +2 Query: 98 GHP-TDEELRLMMAEADTDGDMFISLDDIVGLNAHS 202 GHP T+EEL+ MM EAD DGD FISLD+ V LN + Sbjct: 71 GHPATEEELQRMMGEADADGDGFISLDEFVDLNVRT 106 Score = 31.2 bits (69), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 30 KFDTNEDGMIYEEEFATIFMNLG 98 KFD+N DG I E A IF NLG Sbjct: 49 KFDSNGDGKISSAELAAIFQNLG 71