BLASTX nr result
ID: Alisma22_contig00037324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00037324 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT64093.1 LysM domain-containing GPI-anchored protein 2, partia... 55 6e-07 KMZ72772.1 Pentatricopeptide repeat-containing protein [Zostera ... 55 1e-06 XP_018816431.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 2e-06 XP_015875740.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 6e-06 >JAT64093.1 LysM domain-containing GPI-anchored protein 2, partial [Anthurium amnicola] Length = 284 Score = 55.5 bits (132), Expect = 6e-07 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = +2 Query: 95 PLLPIRMPP------LAPRDCVSLFRSCATLRQLKSLHAAMLRVDLLPHPRFLTTDLVNN 256 P P+ PP L P C +L +SC T+R L S HAAMLR LLP FLTT LV+ Sbjct: 217 PAPPLLSPPRADSWRLQPGSCAALIKSCDTVRALNSAHAAMLRAQLLPGNLFLTTALVSR 276 Query: 257 YS 262 Y+ Sbjct: 277 YA 278 >KMZ72772.1 Pentatricopeptide repeat-containing protein [Zostera marina] Length = 695 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/51 (45%), Positives = 36/51 (70%) Frame = +2 Query: 134 DCVSLFRSCATLRQLKSLHAAMLRVDLLPHPRFLTTDLVNNYSRLGDMSYA 286 +C ++ ++C TL LKS+HA+M R L+P P+FLTT L++ YS+L +A Sbjct: 9 ECAAMIKNCTTLYHLKSIHASMFRSYLIPTPQFLTTQLISKYSQLDAFYHA 59 >XP_018816431.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816432.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816433.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816434.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816435.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] Length = 703 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = +2 Query: 119 PLAPRDCVSLFRSCATLRQLKSLHAAMLRVDLLPHPRFLTTDLVNNYSRLGDMSYA 286 P+ P CVSL + C T++ LKS+HA+MLR L + F +T+L++ Y+ LG MS+A Sbjct: 32 PIEPDTCVSLIKQCRTIQSLKSVHASMLRSHLHSN-LFFSTNLISQYASLGSMSHA 86 >XP_015875740.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Ziziphus jujuba] Length = 706 Score = 52.8 bits (125), Expect = 6e-06 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = +2 Query: 119 PLAPRDCVSLFRSCATLRQLKSLHAAMLRVDLLPHPRFLTTDLVNNYSRLGDMSYA 286 PL C+SL + C TL+ LKS+HA+MLR L + F +T+L+ +Y+ LG +SYA Sbjct: 35 PLEAETCISLIKQCKTLKPLKSVHASMLRTHLHLN-LFFSTNLIAHYASLGSISYA 89