BLASTX nr result
ID: Alisma22_contig00036815
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00036815 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT63144.1 Brain-specific angiogenesis inhibitor 1-associated pr... 53 4e-06 XP_006606741.1 PREDICTED: uncharacterized protein LOC102668220 [... 51 4e-06 >JAT63144.1 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2, partial [Anthurium amnicola] Length = 381 Score = 52.8 bits (125), Expect = 4e-06 Identities = 30/73 (41%), Positives = 38/73 (52%) Frame = -3 Query: 248 GLSLVHDLRLIFPPKGIKLNLDSFWGEDQPEVMDKAEAWILSTENGFRTLEVPNEKKVKF 69 G++LV R + PP SF GE PEV AE WI TE FR + P+E+KV Sbjct: 194 GVALVERFRRMGPP--------SFRGESSPEV---AEGWIRDTEKIFRAIRCPDEEKVPL 242 Query: 68 ATHMLKGGVKIWW 30 AT L+ +WW Sbjct: 243 ATFTLQDRADVWW 255 >XP_006606741.1 PREDICTED: uncharacterized protein LOC102668220 [Glycine max] Length = 126 Score = 50.8 bits (120), Expect = 4e-06 Identities = 26/56 (46%), Positives = 32/56 (57%) Frame = -3 Query: 191 NLDSFWGEDQPEVMDKAEAWILSTENGFRTLEVPNEKKVKFATHMLKGGVKIWWEN 24 NL +F G PE AEAW+ E FR +E + +KV FATHML + WWEN Sbjct: 44 NLPTFKGGYDPE---GAEAWLREIEKIFRVMECQDHQKVLFATHMLADEAEYWWEN 96