BLASTX nr result
ID: Alisma22_contig00036061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00036061 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017639788.1 PREDICTED: RNA-directed DNA polymerase homolog [G... 53 9e-07 XP_012468845.1 PREDICTED: uncharacterized protein LOC105786924 [... 54 1e-06 XP_016733046.1 PREDICTED: RNA-directed DNA polymerase homolog [G... 51 6e-06 XP_017630112.1 PREDICTED: uncharacterized protein LOC108473056 [... 52 7e-06 XP_012468865.1 PREDICTED: uncharacterized protein LOC105786943 [... 52 9e-06 OMO99822.1 reverse transcriptase [Corchorus capsularis] 52 9e-06 XP_007207981.1 hypothetical protein PRUPE_ppa015715mg, partial [... 52 9e-06 >XP_017639788.1 PREDICTED: RNA-directed DNA polymerase homolog [Gossypium arboreum] Length = 164 Score = 53.1 bits (126), Expect = 9e-07 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 234 AVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD 118 AV LL PKKDG RMC+DCR++NKIT K H P RL D Sbjct: 14 AVPVLLVPKKDGTWRMCVDCRAVNKITIKYHHPIPRLDD 52 >XP_012468845.1 PREDICTED: uncharacterized protein LOC105786924 [Gossypium raimondii] Length = 1005 Score = 53.9 bits (128), Expect = 1e-06 Identities = 32/57 (56%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = -2 Query: 234 AVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD--KSYY*SQWFSK*TCKS 70 AV LL PKKDG RMC+DCR+INKIT K H P RL D +Q FSK KS Sbjct: 325 AVPVLLVPKKDGTWRMCVDCRAINKITIKYHHPIPRLDDMLDELSGAQLFSKIDLKS 381 >XP_016733046.1 PREDICTED: RNA-directed DNA polymerase homolog [Gossypium hirsutum] Length = 156 Score = 50.8 bits (120), Expect = 6e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 Query: 237 YAVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD 118 Y V LL PKKDG RMC+DCR++NKIT K P RL D Sbjct: 13 YDVPVLLVPKKDGTWRMCMDCRAVNKITIKYRHPIPRLDD 52 >XP_017630112.1 PREDICTED: uncharacterized protein LOC108473056 [Gossypium arboreum] Length = 709 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 234 AVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD 118 AV LL PKKDGI RMC+DCR++NKIT K P RL D Sbjct: 624 AVPVLLVPKKDGIWRMCVDCRAVNKITIKYRHPIPRLDD 662 >XP_012468865.1 PREDICTED: uncharacterized protein LOC105786943 [Gossypium raimondii] Length = 690 Score = 51.6 bits (122), Expect = 9e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -2 Query: 234 AVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD 118 AV LL PKKDG RMC+DC +INKIT K H P RL D Sbjct: 489 AVPVLLVPKKDGTWRMCVDCHAINKITIKYHHPIPRLDD 527 >OMO99822.1 reverse transcriptase [Corchorus capsularis] Length = 1409 Score = 51.6 bits (122), Expect = 9e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -2 Query: 234 AVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD 118 AV LL PKKDG RMC+DCR+IN IT K H P RL D Sbjct: 695 AVPVLLVPKKDGTWRMCVDCRAINNITVKYHHPIPRLDD 733 >XP_007207981.1 hypothetical protein PRUPE_ppa015715mg, partial [Prunus persica] Length = 1445 Score = 51.6 bits (122), Expect = 9e-06 Identities = 29/52 (55%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -2 Query: 234 AVRALLAPKKDGI*RMCLDCRSINKITNKCHCPTHRLSD--KSYY*SQWFSK 85 AV LL PKKDG RMC+D R++NKIT K P RL D SQWFSK Sbjct: 580 AVPVLLTPKKDGSWRMCVDSRAVNKITVKYRFPIPRLEDMLDDLAGSQWFSK 631