BLASTX nr result
ID: Alisma22_contig00035884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00035884 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP63559.1 Retrovirus-related Pol polyprotein from transposon TN... 55 8e-07 KYP54934.1 Retrovirus-related Pol polyprotein from transposon TN... 54 2e-06 KHN06274.1 Retrovirus-related Pol polyprotein from transposon TN... 54 3e-06 KOM54435.1 hypothetical protein LR48_Vigan10g032700 [Vigna angul... 52 4e-06 >KYP63559.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1378 Score = 55.5 bits (132), Expect = 8e-07 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = -3 Query: 296 LDYPFSQKGYKCLEPNSGRIYISADVTFHEDEMFFSSSSPPIDCIDTMVSLP 141 L Y QKGY+C P++ R Y+SADVTF ED FFSSS +D I ++ +P Sbjct: 698 LGYSRLQKGYRCYSPDTRRYYMSADVTFFEDTSFFSSSMQVLDSIQQVLPVP 749 >KYP54934.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 227 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = -3 Query: 296 LDYPFSQKGYKCLEPNSGRIYISADVTFHEDEMFFSSS--SPPIDCI 162 + Y ++KGYKC P S R+Y+S DVTFHE E FFSS+ S + C+ Sbjct: 164 IGYASNKKGYKCYHPQSRRVYVSKDVTFHETESFFSSTHLSSELKCL 210 >KHN06274.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1353 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/54 (46%), Positives = 33/54 (61%) Frame = -3 Query: 296 LDYPFSQKGYKCLEPNSGRIYISADVTFHEDEMFFSSSSPPIDCIDTMVSLPDP 135 L Y QKGYKC P++ R Y+SADVTF ED F+ SS+ I ++ +P P Sbjct: 679 LGYSRLQKGYKCFSPSTRRYYMSADVTFFEDTPFYPSSTDHSSSIQNVLPIPSP 732 >KOM54435.1 hypothetical protein LR48_Vigan10g032700 [Vigna angularis] Length = 160 Score = 52.0 bits (123), Expect = 4e-06 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -3 Query: 296 LDYPFSQKGYKCLEPNSGRIYISADVTFHEDEMFFSSSSPPIDCIDTMVSLP 141 L Y QKGYKC P++ R Y+SADVTF ED FF SS + M LP Sbjct: 79 LGYSRLQKGYKCYSPSTKRYYMSADVTFFEDTPFFPSSMEDRSSVQQMFPLP 130