BLASTX nr result
ID: Alisma22_contig00035728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00035728 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012897745.1 uncharacterized protein [Blastocystis hominis] CB... 54 3e-06 >XP_012897745.1 uncharacterized protein [Blastocystis hominis] CBK23697.2 unnamed protein product [Blastocystis hominis] Length = 221 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/70 (34%), Positives = 33/70 (47%) Frame = +2 Query: 8 GHWQHQCLSLVVCFRCRSPGHRARDCLGALAGGRCPSFPRDRCLRCLKHGLRRSHCSSPT 187 GH C + +VC RC PGH+AR+C C RC + G S C +P Sbjct: 155 GHLARDCQNEIVCSRCEQPGHKARECKN-----------EPVCYRCKQSGHISSACPNPI 203 Query: 188 IYFRCKSPGH 217 + ++C PGH Sbjct: 204 VCYKCGQPGH 213