BLASTX nr result
ID: Alisma22_contig00035106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00035106 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010465341.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 2e-08 XP_016452067.1 PREDICTED: BTB/POZ domain-containing protein At1g... 57 3e-08 OAY31717.1 hypothetical protein MANES_14G134600 [Manihot esculenta] 61 3e-08 KJB55402.1 hypothetical protein B456_009G074400 [Gossypium raimo... 59 1e-07 XP_012446409.1 PREDICTED: BTB/POZ domain-containing protein At1g... 59 1e-07 XP_017627218.1 PREDICTED: BTB/POZ domain-containing protein At1g... 59 1e-07 XP_016189212.1 PREDICTED: BTB/POZ domain-containing protein At1g... 59 1e-07 XP_015954977.1 PREDICTED: BTB/POZ domain-containing protein At1g... 59 1e-07 XP_006306917.1 hypothetical protein CARUB_v10008482mg [Capsella ... 59 2e-07 XP_017983502.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 EOY32777.1 BZIP domain class transcription factor [Theobroma cacao] 58 3e-07 CDX90249.1 BnaA08g17350D [Brassica napus] 58 3e-07 XP_012075651.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 XP_002281182.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 XP_013656806.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 XP_009109587.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 XP_018488918.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 XP_013662463.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 JAU37703.1 BTB/POZ domain-containing protein [Noccaea caerulesce... 58 3e-07 XP_009115147.1 PREDICTED: BTB/POZ domain-containing protein At1g... 58 3e-07 >XP_010465341.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 [Camelina sativa] Length = 108 Score = 57.8 bits (138), Expect = 2e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_016452067.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like, partial [Nicotiana tabacum] Length = 97 Score = 57.4 bits (137), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKTDAFQRKGQAWFCTTGLPSDIV 31 >OAY31717.1 hypothetical protein MANES_14G134600 [Manihot esculenta] Length = 635 Score = 60.8 bits (146), Expect = 3e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+RHGQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRHGQAWFCTTGLPSDIV 31 >KJB55402.1 hypothetical protein B456_009G074400 [Gossypium raimondii] Length = 590 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAFKR GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKTDAFKRQGQAWFCTTGLPSDIV 31 >XP_012446409.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like isoform X1 [Gossypium raimondii] XP_012446410.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like isoform X1 [Gossypium raimondii] KJB55403.1 hypothetical protein B456_009G074400 [Gossypium raimondii] Length = 634 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAFKR GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKTDAFKRQGQAWFCTTGLPSDIV 31 >XP_017627218.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like isoform X1 [Gossypium arboreum] KHF98556.1 hypothetical protein F383_12747 [Gossypium arboreum] Length = 634 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAFKR GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKTDAFKRQGQAWFCTTGLPSDIV 31 >XP_016189212.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Arachis ipaensis] Length = 648 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MAC++LGSKPDAF+R GQAWF TTGLP+DIV Sbjct: 1 MACVKLGSKPDAFQRQGQAWFCTTGLPSDIV 31 >XP_015954977.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Arachis duranensis] Length = 648 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MAC++LGSKPDAF+R GQAWF TTGLP+DIV Sbjct: 1 MACVKLGSKPDAFQRQGQAWFCTTGLPSDIV 31 >XP_006306917.1 hypothetical protein CARUB_v10008482mg [Capsella rubella] EOA39815.1 hypothetical protein CARUB_v10008482mg [Capsella rubella] Length = 688 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 106 RSVGMACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 R+ MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 18 RAETMACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 52 >XP_017983502.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 isoform X1 [Theobroma cacao] Length = 631 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKTDAFRRQGQAWFCTTGLPSDIV 31 >EOY32777.1 BZIP domain class transcription factor [Theobroma cacao] Length = 631 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKTDAFRRQGQAWFCTTGLPSDIV 31 >CDX90249.1 BnaA08g17350D [Brassica napus] Length = 631 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_012075651.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 isoform X1 [Jatropha curcas] KDP34960.1 hypothetical protein JCGZ_09248 [Jatropha curcas] Length = 632 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_002281182.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 [Vitis vinifera] CBI30985.3 unnamed protein product, partial [Vitis vinifera] Length = 632 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_013656806.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brassica napus] Length = 656 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_009109587.1 PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brassica rapa] Length = 656 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_018488918.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 [Raphanus sativus] XP_018438377.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 [Raphanus sativus] Length = 657 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_013662463.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 isoform X1 [Brassica napus] XP_013662464.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 isoform X2 [Brassica napus] CDY02293.1 BnaA09g26090D [Brassica napus] Length = 659 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >JAU37703.1 BTB/POZ domain-containing protein [Noccaea caerulescens] JAU76127.1 BTB/POZ domain-containing protein [Noccaea caerulescens] Length = 660 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31 >XP_009115147.1 PREDICTED: BTB/POZ domain-containing protein At1g30440 [Brassica rapa] Length = 661 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 MACMRLGSKPDAFKRHGQAWFSTTGLPTDIV 2 MACM+LGSK DAF+R GQAWF TTGLP+DIV Sbjct: 1 MACMKLGSKSDAFQRQGQAWFCTTGLPSDIV 31