BLASTX nr result
ID: Alisma22_contig00034851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00034851 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT62693.1 Disease resistance protein RGA2, partial [Anthurium a... 59 2e-08 >JAT62693.1 Disease resistance protein RGA2, partial [Anthurium amnicola] Length = 366 Score = 58.9 bits (141), Expect = 2e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 161 MAMVLDAFVGFFVERLGVLVEEEIVRQIGVKDALNQLKATLRTLKMLLADAE 6 MAMVLDAFV FFVER+G LV E+ Q+GV+D L+ LK L L+ L DAE Sbjct: 1 MAMVLDAFVSFFVERVGDLVLAEVALQLGVEDDLHTLKTRLEGLRAFLRDAE 52