BLASTX nr result
ID: Alisma22_contig00034157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00034157 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU11040.1 hypothetical protein TSUD_113330 [Trifolium subterran... 58 5e-07 JAU99167.1 Copia protein, partial [Noccaea caerulescens] 54 6e-07 KYP63600.1 Retrovirus-related Pol polyprotein from transposon TN... 55 6e-06 >GAU11040.1 hypothetical protein TSUD_113330 [Trifolium subterraneum] Length = 1355 Score = 58.2 bits (139), Expect = 5e-07 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -2 Query: 188 IRFWSEAILTF-ILINQKLSFVLKGKTPYSVFHRPKRPFSFQARIFGCIAFVHNYDLEAD 12 I FW E ILT LIN+ S VL GKTPY + H K+P R+FGC+ +VHN + + D Sbjct: 568 IEFWGECILTAGYLINRTPSLVLHGKTPYEILHG-KQPSLEHIRVFGCLCYVHNQNHKGD 626 Query: 11 K 9 K Sbjct: 627 K 627 >JAU99167.1 Copia protein, partial [Noccaea caerulescens] Length = 96 Score = 54.3 bits (129), Expect = 6e-07 Identities = 27/61 (44%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -2 Query: 188 IRFWSEAILTFI-LINQKLSFVLKGKTPYSVFHRPKRPFSFQARIFGCIAFVHNYDLEAD 12 I+FW E ILT LIN+ S +L+GKTPY + ++ P S R+FGC+ + HN + + D Sbjct: 29 IQFWGECILTAAYLINRTPSVLLQGKTPYELLYKTA-PSSSHLRVFGCLCYAHNQNHKGD 87 Query: 11 K 9 K Sbjct: 88 K 88 >KYP63600.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 334 Score = 54.7 bits (130), Expect = 6e-06 Identities = 35/79 (44%), Positives = 45/79 (56%), Gaps = 2/79 (2%) Frame = -2 Query: 236 VEICKTK*LVLTW*INIRFWSEAILTF-ILINQKLSFVLKGKTPYSVFHRPKRP-FSFQA 63 VE +T L+L + + W +AILT LIN+ S L+ KTPYS+ + PK P F Sbjct: 191 VETVRT--LMLNTNVPVHHWGDAILTSCFLINRMPSSSLENKTPYSIIY-PKEPLFHVSP 247 Query: 62 RIFGCIAFVHNYDLEADKL 6 R+FGC FVHN DKL Sbjct: 248 RVFGCTCFVHNVSPGLDKL 266