BLASTX nr result
ID: Alisma22_contig00033603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00033603 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020096408.1 protein ROOT PRIMORDIUM DEFECTIVE 1 [Ananas comos... 53 3e-06 KMZ70491.1 Ubiquitin carboxyl-terminal hydrolase family protein ... 53 4e-06 >XP_020096408.1 protein ROOT PRIMORDIUM DEFECTIVE 1 [Ananas comosus] XP_020096409.1 protein ROOT PRIMORDIUM DEFECTIVE 1 [Ananas comosus] XP_020096411.1 protein ROOT PRIMORDIUM DEFECTIVE 1 [Ananas comosus] Length = 392 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = +2 Query: 119 FNSPLTSCSALRFLQRSTYVNVRMKWKKDPFYDTLDVVNRSKELR 253 F+SP+ + A + RSTYV+V MKWKKDPFYD++ V+ RS++L+ Sbjct: 15 FSSPVRTL-AFSLVHRSTYVDVAMKWKKDPFYDSIGVLARSRDLK 58 >KMZ70491.1 Ubiquitin carboxyl-terminal hydrolase family protein [Zostera marina] Length = 413 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 170 TYVNVRMKWKKDPFYDTLDVVNRSKELR 253 TYVNVR KWKKD FYDTL+VVN SKEL+ Sbjct: 28 TYVNVRTKWKKDTFYDTLEVVNESKELK 55