BLASTX nr result
ID: Alisma22_contig00033232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00033232 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OEL31183.1 Auxin-responsive protein IAA31 [Dichanthelium oligosa... 71 7e-12 XP_015628435.1 PREDICTED: auxin-responsive protein IAA12 [Oryza ... 68 7e-11 XP_020201530.1 auxin-responsive protein IAA12-like [Aegilops tau... 67 1e-10 EMT18553.1 Auxin-responsive protein IAA12 [Aegilops tauschii] 67 1e-10 XP_002442477.1 hypothetical protein SORBIDRAFT_08g020590 [Sorghu... 68 1e-10 XP_006650322.1 PREDICTED: auxin-responsive protein IAA12-like [O... 67 2e-10 XP_006664715.1 PREDICTED: auxin-responsive protein IAA31-like [O... 65 7e-10 XP_004982375.1 PREDICTED: auxin-responsive protein IAA12-like [S... 64 2e-09 ADL70749.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 2e-09 ADL70760.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 2e-09 XP_004963101.1 PREDICTED: auxin-responsive protein IAA31-like [S... 64 2e-09 ADL70757.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 2e-09 ADL70750.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 2e-09 ADL70755.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 2e-09 ADL70759.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 2e-09 ADB93662.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 3e-09 ADL70754.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 3e-09 ADL70752.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 3e-09 ADL70756.1 indole-3-acetic acid inducible 27, partial [Arabidops... 64 3e-09 ONM01869.1 Auxin-responsive protein IAA4 [Zea mays] 64 3e-09 >OEL31183.1 Auxin-responsive protein IAA31 [Dichanthelium oligosanthes] Length = 220 Score = 70.9 bits (172), Expect = 7e-12 Identities = 38/72 (52%), Positives = 45/72 (62%), Gaps = 5/72 (6%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKA--ADGTSKKEAPAAPGISSSG--- 478 R PP AK+QVVGWPPV+S+R C S G K+ A K APAAP +++G Sbjct: 63 RDGETAPPAAKAQVVGWPPVRSYRKSCFQQSSGAKSKPAPAEEKAPAPAAPSAAAAGGNA 122 Query: 479 LLVKVSMDGAPY 514 L VKVSMDGAPY Sbjct: 123 LFVKVSMDGAPY 134 >XP_015628435.1 PREDICTED: auxin-responsive protein IAA12 [Oryza sativa Japonica Group] Q75GK1.1 RecName: Full=Auxin-responsive protein IAA12; AltName: Full=Indoleacetic acid-induced protein 12 AAS07279.1 putative auxin-induced protein [Oryza sativa Japonica Group] ABF97771.1 AUX/IAA family protein, expressed [Oryza sativa Japonica Group] BAF12628.1 Os03g0633800 [Oryza sativa Japonica Group] EAY91116.1 hypothetical protein OsI_12725 [Oryza sativa Indica Group] EAZ27869.1 hypothetical protein OsJ_11822 [Oryza sativa Japonica Group] BAG93263.1 unnamed protein product [Oryza sativa Japonica Group] BAS85384.1 Os03g0633800 [Oryza sativa Japonica Group] Length = 226 Score = 68.2 bits (165), Expect = 7e-11 Identities = 40/87 (45%), Positives = 51/87 (58%), Gaps = 16/87 (18%) Frame = +2 Query: 302 NDNHRSAAEVPPPAKSQVVGWPPVQSFRVRC-----SAASQGKKAADGTSKKEAP----A 454 +D H + PP AK+QVVGWPPV+S+R C +AAS+ K A + K+ P A Sbjct: 54 DDEHDAVEAAPPVAKAQVVGWPPVRSYRKSCFQQQSAAASKSKAAVSSCNNKDEPITKNA 113 Query: 455 APGISSS-------GLLVKVSMDGAPY 514 AP ++S G LVKVSMDGAPY Sbjct: 114 APAPAASSAAAANGGSLVKVSMDGAPY 140 >XP_020201530.1 auxin-responsive protein IAA12-like [Aegilops tauschii subsp. tauschii] Length = 215 Score = 67.4 bits (163), Expect = 1e-10 Identities = 35/74 (47%), Positives = 45/74 (60%), Gaps = 4/74 (5%) Frame = +2 Query: 305 DNHRSAAEVPPPAKSQVVGWPPVQSFRVRC----SAASQGKKAADGTSKKEAPAAPGISS 472 D PP AK+QVVGWPPV+S+R C ++ S+ KKA + +S AA S+ Sbjct: 56 DRSDDVETAPPVAKAQVVGWPPVRSYRKSCFQAAASKSKAKKADEASSNNTPSAAAPAST 115 Query: 473 SGLLVKVSMDGAPY 514 +G VKVSMDGAPY Sbjct: 116 NGSFVKVSMDGAPY 129 >EMT18553.1 Auxin-responsive protein IAA12 [Aegilops tauschii] Length = 215 Score = 67.4 bits (163), Expect = 1e-10 Identities = 35/74 (47%), Positives = 45/74 (60%), Gaps = 4/74 (5%) Frame = +2 Query: 305 DNHRSAAEVPPPAKSQVVGWPPVQSFRVRC----SAASQGKKAADGTSKKEAPAAPGISS 472 D PP AK+QVVGWPPV+S+R C ++ S+ KKA + +S AA S+ Sbjct: 56 DRSDDVETAPPVAKAQVVGWPPVRSYRKSCFQAAASKSKAKKADEASSNNTPSAAAPAST 115 Query: 473 SGLLVKVSMDGAPY 514 +G VKVSMDGAPY Sbjct: 116 NGSFVKVSMDGAPY 129 >XP_002442477.1 hypothetical protein SORBIDRAFT_08g020590 [Sorghum bicolor] EES16315.1 hypothetical protein SORBI_008G157000 [Sorghum bicolor] Length = 244 Score = 67.8 bits (164), Expect = 1e-10 Identities = 37/68 (54%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = +2 Query: 317 SAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPG--ISSSGLLVK 490 +A PP AK+QVVGWPPV+S+R C Q + AA K APAAP ++GL VK Sbjct: 91 NADAAPPAAKAQVVGWPPVRSYRKSCFQQQQQQAAA---KSKPAPAAPAEEAPATGLFVK 147 Query: 491 VSMDGAPY 514 VSMDGAPY Sbjct: 148 VSMDGAPY 155 >XP_006650322.1 PREDICTED: auxin-responsive protein IAA12-like [Oryza brachyantha] Length = 216 Score = 66.6 bits (161), Expect = 2e-10 Identities = 37/78 (47%), Positives = 48/78 (61%), Gaps = 8/78 (10%) Frame = +2 Query: 305 DNHRSAAEVPPPAKSQVVGWPPVQSFRVRC--SAASQGKKAA------DGTSKKEAPAAP 460 D + PP AK+QVVGWPPV+S+R C +AAS+ K A + T+K A A Sbjct: 52 DEQDAVEAAPPVAKAQVVGWPPVRSYRKSCFQAAASKSKAAVSCNNKDEPTTKNAAQAPA 111 Query: 461 GISSSGLLVKVSMDGAPY 514 +++G LVKVSMDGAPY Sbjct: 112 AAAANGSLVKVSMDGAPY 129 >XP_006664715.1 PREDICTED: auxin-responsive protein IAA31-like [Oryza brachyantha] Length = 199 Score = 65.1 bits (157), Expect = 7e-10 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +2 Query: 317 SAAEVPPPAKSQVVGWPPVQSFRVRC-SAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 +AA PP AK+QVVGWPPV+S+R C + + K AA+ +++ A G GL VKV Sbjct: 53 AAAAAPPAAKAQVVGWPPVRSYRKSCLQTSGRSKPAAEAPPQQQKEEAAG----GLFVKV 108 Query: 494 SMDGAPY 514 SMDGAPY Sbjct: 109 SMDGAPY 115 >XP_004982375.1 PREDICTED: auxin-responsive protein IAA12-like [Setaria italica] KQK88017.1 hypothetical protein SETIT_037452mg [Setaria italica] Length = 217 Score = 64.3 bits (155), Expect = 2e-09 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 7/72 (9%) Frame = +2 Query: 320 AAEVPPPAKSQVVGWPPVQSFRVRCSAASQ-------GKKAADGTSKKEAPAAPGISSSG 478 A PP AK+ VVGWPPV+S+R C AS ++AA +S AP+A +++G Sbjct: 65 AEAAPPAAKAPVVGWPPVRSYRKSCFKASSKQISKATKEEAAPASSNAAAPSAAASTTTG 124 Query: 479 LLVKVSMDGAPY 514 VKVSMDGAPY Sbjct: 125 SFVKVSMDGAPY 136 >ADL70749.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 226 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 92 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 151 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 152 SMEGAPY 158 >ADL70760.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 233 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 92 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 151 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 152 SMEGAPY 158 >XP_004963101.1 PREDICTED: auxin-responsive protein IAA31-like [Setaria italica] KQL17091.1 hypothetical protein SETIT_025180mg [Setaria italica] Length = 209 Score = 63.9 bits (154), Expect = 2e-09 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRC---SAASQGKKAADGTSKKEAPAAPGISSSGLL 484 R PP AK+QVVGWPPV+S+R C S++S K +++AP A G + S L Sbjct: 54 RDGETAPPAAKAQVVGWPPVRSYRKSCFQQSSSSATKTKPAPAPEEKAPPAAG-AGSALF 112 Query: 485 VKVSMDGAPY 514 VKVSMDGAPY Sbjct: 113 VKVSMDGAPY 122 >ADL70757.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 242 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 108 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 167 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 168 SMEGAPY 174 >ADL70750.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 242 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 107 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 166 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 167 SMEGAPY 173 >ADL70755.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 243 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 107 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 166 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 167 SMEGAPY 173 >ADL70759.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 247 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 106 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 165 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 166 SMEGAPY 172 >ADB93662.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 248 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 107 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 166 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 167 SMEGAPY 173 >ADL70754.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 248 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 107 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 166 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 167 SMEGAPY 173 >ADL70752.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 248 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 107 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 166 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 167 SMEGAPY 173 >ADL70756.1 indole-3-acetic acid inducible 27, partial [Arabidopsis thaliana] Length = 249 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +2 Query: 314 RSAAEVPPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKV 493 + ++ P +K+QVVGWPP++SFR A+SQ +K + + +EA A G L VKV Sbjct: 122 KKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKV 181 Query: 494 SMDGAPY 514 SM+GAPY Sbjct: 182 SMEGAPY 188 >ONM01869.1 Auxin-responsive protein IAA4 [Zea mays] Length = 199 Score = 63.5 bits (153), Expect = 3e-09 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +2 Query: 332 PPPAKSQVVGWPPVQSFRVRCSAASQGKKAADGTSKKEAPAAPGISSSGLLVKVSMDGAP 511 PP AK+QVVGWPPV+S+R C Q + A G APG + G+ VKVSMDGAP Sbjct: 75 PPAAKAQVVGWPPVRSYRKSC--FQQQQAGAKGKPAAADEGAPGPAGGGVFVKVSMDGAP 132 Query: 512 Y 514 Y Sbjct: 133 Y 133