BLASTX nr result
ID: Alisma22_contig00033187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00033187 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019073963.1 PREDICTED: uncharacterized protein LOC109122135, ... 52 1e-05 >XP_019073963.1 PREDICTED: uncharacterized protein LOC109122135, partial [Vitis vinifera] Length = 314 Score = 52.0 bits (123), Expect = 1e-05 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -3 Query: 174 SIYGLEQPPRARYHKFRQSLQNFVYIPARTDTSLFIFQTPSLSYMIWYMFGDVILTQN 1 +IYGL+Q PRA YH+ RQ L F +I + DTSLFIF + + D+I+T N Sbjct: 24 AIYGLKQAPRAWYHELRQFLLQFGFINSIIDTSLFIFNNHGTIFYLLVYVDDIIITGN 81