BLASTX nr result
ID: Alisma22_contig00033144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00033144 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY19415.1 Spc97 / Spc98 family of spindle pole body (SBP) compo... 76 1e-13 EOY19414.1 Spc97 / Spc98 family of spindle pole body (SBP) compo... 76 1e-13 XP_017984961.1 PREDICTED: gamma-tubulin complex component 5 [The... 76 1e-13 EOY19412.1 Spc97 / Spc98 family of spindle pole body component i... 76 1e-13 KHG22372.1 Gamma-tubulin complex component 5 [Gossypium arboreum] 75 2e-13 GAV69020.1 Spc97_Spc98 domain-containing protein [Cephalotus fol... 75 2e-13 XP_010248230.1 PREDICTED: gamma-tubulin complex component 5 [Nel... 75 2e-13 XP_017649893.1 PREDICTED: gamma-tubulin complex component 5 [Gos... 75 2e-13 XP_016676848.1 PREDICTED: gamma-tubulin complex component 5-like... 75 2e-13 XP_015582103.1 PREDICTED: gamma-tubulin complex component 5 isof... 75 3e-13 EEF31202.1 transferase, transferring glycosyl groups, putative [... 75 3e-13 JAT44604.1 Gamma-tubulin complex component 5 [Anthurium amnicola... 75 3e-13 XP_015582102.1 PREDICTED: gamma-tubulin complex component 5 isof... 75 3e-13 XP_015582101.1 PREDICTED: gamma-tubulin complex component 5 isof... 75 3e-13 XP_015582100.1 PREDICTED: gamma-tubulin complex component 5 isof... 75 3e-13 XP_011459595.1 PREDICTED: gamma-tubulin complex component 5-like... 75 3e-13 XP_011654089.1 PREDICTED: gamma-tubulin complex component 5 isof... 75 4e-13 XP_008452498.1 PREDICTED: gamma-tubulin complex component 5-like... 75 4e-13 XP_008795988.1 PREDICTED: uncharacterized protein LOC103711564 i... 75 4e-13 XP_008452497.1 PREDICTED: gamma-tubulin complex component 5-like... 75 4e-13 >EOY19415.1 Spc97 / Spc98 family of spindle pole body (SBP) component, putative isoform 4 [Theobroma cacao] Length = 794 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQGRQN 228 K+NVGHFPHLADLV RINYN+FYMS+ GNL+TTPS E A++RL + N Sbjct: 746 KLNVGHFPHLADLVARINYNNFYMSDGGNLMTTPSSESATARLGKAFAN 794 >EOY19414.1 Spc97 / Spc98 family of spindle pole body (SBP) component, putative isoform 3 [Theobroma cacao] Length = 866 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQGRQN 228 K+NVGHFPHLADLV RINYN+FYMS+ GNL+TTPS E A++RL + N Sbjct: 818 KLNVGHFPHLADLVARINYNNFYMSDGGNLMTTPSSESATARLGKAFAN 866 >XP_017984961.1 PREDICTED: gamma-tubulin complex component 5 [Theobroma cacao] Length = 1020 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQGRQN 228 K+NVGHFPHLADLV RINYN+FYMS+ GNL+TTPS E A++RL + N Sbjct: 972 KLNVGHFPHLADLVARINYNNFYMSDGGNLMTTPSSESATARLGKAFAN 1020 >EOY19412.1 Spc97 / Spc98 family of spindle pole body component isoform 1 [Theobroma cacao] Length = 1020 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQGRQN 228 K+NVGHFPHLADLV RINYN+FYMS+ GNL+TTPS E A++RL + N Sbjct: 972 KLNVGHFPHLADLVARINYNNFYMSDGGNLMTTPSSESATARLGKAFAN 1020 >KHG22372.1 Gamma-tubulin complex component 5 [Gossypium arboreum] Length = 962 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+ GNL+T PS E A++RL + Sbjct: 914 KLNVGHFPHLADLVTRINYNNFYMSDGGNLMTAPSSETAAARLGK 958 >GAV69020.1 Spc97_Spc98 domain-containing protein [Cephalotus follicularis] Length = 1011 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+SGNL+T P E +SRL + Sbjct: 966 KLNVGHFPHLADLVTRINYNYFYMSDSGNLMTAPGSETVNSRLGK 1010 >XP_010248230.1 PREDICTED: gamma-tubulin complex component 5 [Nelumbo nucifera] Length = 1019 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN++YMS+SGNLLT P E ++SRL + Sbjct: 968 KLNVGHFPHLADLVTRINYNYYYMSDSGNLLTVPGSETSASRLGK 1012 >XP_017649893.1 PREDICTED: gamma-tubulin complex component 5 [Gossypium arboreum] Length = 1020 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+ GNL+T PS E A++RL + Sbjct: 972 KLNVGHFPHLADLVTRINYNNFYMSDGGNLMTAPSSETAAARLGK 1016 >XP_016676848.1 PREDICTED: gamma-tubulin complex component 5-like [Gossypium hirsutum] Length = 1020 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+ GNL+T PS E A++RL + Sbjct: 972 KLNVGHFPHLADLVTRINYNNFYMSDGGNLMTAPSSETAAARLGK 1016 >XP_015582103.1 PREDICTED: gamma-tubulin complex component 5 isoform X4 [Ricinus communis] Length = 831 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+SGNL+T S E A+SRL + Sbjct: 782 KLNVGHFPHLADLVTRINYNYFYMSDSGNLMTATSSESATSRLGK 826 >EEF31202.1 transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 863 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+SGNL+T S E A+SRL + Sbjct: 814 KLNVGHFPHLADLVTRINYNYFYMSDSGNLMTATSSESATSRLGK 858 >JAT44604.1 Gamma-tubulin complex component 5 [Anthurium amnicola] JAT56119.1 Gamma-tubulin complex component 5 [Anthurium amnicola] Length = 866 Score = 75.1 bits (183), Expect = 3e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFE 264 K+NVG FPHLADLVTRINYNHFYMS+ GNLLTTPSFE Sbjct: 817 KLNVGQFPHLADLVTRINYNHFYMSDDGNLLTTPSFE 853 >XP_015582102.1 PREDICTED: gamma-tubulin complex component 5 isoform X3 [Ricinus communis] Length = 947 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+SGNL+T S E A+SRL + Sbjct: 898 KLNVGHFPHLADLVTRINYNYFYMSDSGNLMTATSSESATSRLGK 942 >XP_015582101.1 PREDICTED: gamma-tubulin complex component 5 isoform X2 [Ricinus communis] Length = 969 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+SGNL+T S E A+SRL + Sbjct: 920 KLNVGHFPHLADLVTRINYNYFYMSDSGNLMTATSSESATSRLGK 964 >XP_015582100.1 PREDICTED: gamma-tubulin complex component 5 isoform X1 [Ricinus communis] Length = 970 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYN+FYMS+SGNL+T S E A+SRL + Sbjct: 921 KLNVGHFPHLADLVTRINYNYFYMSDSGNLMTATSSESATSRLGK 965 >XP_011459595.1 PREDICTED: gamma-tubulin complex component 5-like [Fragaria vesca subsp. vesca] Length = 973 Score = 75.1 bits (183), Expect = 3e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINYNHFYMS++GNL T PS E +SRL + Sbjct: 922 KLNVGHFPHLADLVTRINYNHFYMSDTGNLRTLPSSENITSRLGK 966 >XP_011654089.1 PREDICTED: gamma-tubulin complex component 5 isoform X3 [Cucumis sativus] Length = 841 Score = 74.7 bits (182), Expect = 4e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINY++FYMS+SGNL T PS E SSRL + Sbjct: 790 KLNVGHFPHLADLVTRINYSYFYMSDSGNLRTAPSSETVSSRLGK 834 >XP_008452498.1 PREDICTED: gamma-tubulin complex component 5-like isoform X3 [Cucumis melo] Length = 841 Score = 74.7 bits (182), Expect = 4e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINY++FYMS+SGNL T PS E SSRL + Sbjct: 790 KLNVGHFPHLADLVTRINYSYFYMSDSGNLRTAPSSETVSSRLGK 834 >XP_008795988.1 PREDICTED: uncharacterized protein LOC103711564 isoform X4 [Phoenix dactylifera] Length = 869 Score = 74.7 bits (182), Expect = 4e-13 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQGRQ 231 K+NVGHFPHLADLVTRINYN+FYMS+SGNLLT P+FE ++ G Q Sbjct: 821 KLNVGHFPHLADLVTRINYNYFYMSDSGNLLTVPNFESSAKPGKTGFQ 868 >XP_008452497.1 PREDICTED: gamma-tubulin complex component 5-like isoform X2 [Cucumis melo] Length = 984 Score = 74.7 bits (182), Expect = 4e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 374 KINVGHFPHLADLVTRINYNHFYMSESGNLLTTPSFELASSRLSQ 240 K+NVGHFPHLADLVTRINY++FYMS+SGNL T PS E SSRL + Sbjct: 933 KLNVGHFPHLADLVTRINYSYFYMSDSGNLRTAPSSETVSSRLGK 977