BLASTX nr result
ID: Alisma22_contig00032941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00032941 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMT03682.1 hypothetical protein BVRB_8g190190 [Beta vulgaris sub... 80 7e-17 GAV79563.1 UBN2 domain-containing protein, partial [Cephalotus f... 78 8e-17 GAV89717.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 1e-16 GAV58057.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 1e-16 GAV66637.1 UBN2 domain-containing protein, partial [Cephalotus f... 78 1e-16 GAV62841.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 1e-16 GAV67719.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 1e-16 GAV79213.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 1e-16 GAV65951.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV67716.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV71872.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV73727.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV88438.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV82053.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV73943.1 UBN2 domain-containing protein, partial [Cephalotus f... 76 2e-16 GAV78973.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV67578.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV79207.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV64827.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 GAV71061.1 UBN2 domain-containing protein, partial [Cephalotus f... 77 2e-16 >KMT03682.1 hypothetical protein BVRB_8g190190 [Beta vulgaris subsp. vulgaris] Length = 217 Score = 80.1 bits (196), Expect = 7e-17 Identities = 37/70 (52%), Positives = 50/70 (71%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W L +T++GT +VK SKI ML K+E F+M P ES+ EM +FS+I+N L +LGK + Sbjct: 80 WELLQVTHQGTNEVKRSKIDMLMHKYELFQMKPKESVQEMLTRFSNIINELESLGKIITP 139 Query: 183 EDQVSKVLRS 212 E+QV KVLRS Sbjct: 140 EEQVRKVLRS 149 >GAV79563.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 78.2 bits (191), Expect = 8e-17 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK SK+SML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 61 WDRLEVTYEGTNQVKESKVSMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV89717.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 112 Score = 77.0 bits (188), Expect = 1e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 30 WDRLEVTYEGTNQVKEAKISMLVHEYEIFTMNENEDIKSMFSRFTNIINALQALDKTYSN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 NEMVRKILR 98 >GAV58057.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 126 Score = 77.4 bits (189), Expect = 1e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 30 WDRLEVTYEGTNQVKEAKISMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 SEMVRKILR 98 >GAV66637.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.8 bits (190), Expect = 1e-16 Identities = 37/69 (53%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F+SI+N L AL KT Sbjct: 61 WVRLEVTYEGTNQVKEAKISMLVHEYEMFTMNKNEDIKSMFSRFTSIINALQALDKTYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV62841.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 130 Score = 77.4 bits (189), Expect = 1e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 9 WDRLEVTYEGTNQVKEAKISMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 68 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 69 SEMVRKILR 77 >GAV67719.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 126 Score = 77.0 bits (188), Expect = 1e-16 Identities = 36/69 (52%), Positives = 47/69 (68%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML +E F M+ NE I MF++F++I+N L AL KT Sbjct: 30 WDRLEVTYEGTNQVKEAKISMLVHDYEMFTMNENEDIKSMFSRFTNIINALQALDKTYYN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 SEMVRKILR 98 >GAV79213.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 126 Score = 77.0 bits (188), Expect = 1e-16 Identities = 35/69 (50%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +K+SML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 30 WDRLEVTYEGTNQVKEAKVSMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 SEMVRKILR 98 >GAV65951.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.4 bits (189), Expect = 2e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 61 WDRLEVTYEGTNQVKEAKISMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV67716.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.4 bits (189), Expect = 2e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 61 WDRLEVTYEGTNQVKEAKISMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV71872.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.4 bits (189), Expect = 2e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 61 WDRLEVTYEGTNQVKEAKISMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV73727.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.4 bits (189), Expect = 2e-16 Identities = 35/69 (50%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +K+SML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 61 WDRLEVTYEGTNQVKEAKVSMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYTN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV88438.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.4 bits (189), Expect = 2e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML K+E F M+ NE I MF++F++I+N L AL K+ Sbjct: 61 WDRLEVTYEGTNQVKEAKISMLVHKYEMFTMNENEDIKSMFSRFTNIINALQALDKSYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV82053.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 128 Score = 77.0 bits (188), Expect = 2e-16 Identities = 35/69 (50%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +K+SML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 7 WDRLEVTYEGTNQVKEAKVSMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALDKTYSN 66 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 67 SEMVRKILR 75 >GAV73943.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 102 Score = 76.3 bits (186), Expect = 2e-16 Identities = 35/69 (50%), Positives = 47/69 (68%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +K+SML ++E F M+ NE I MF +F++I+N L AL KT Sbjct: 6 WDRLEVTYEGTNQVKEAKVSMLVHEYEMFTMNENEDIKSMFPRFTNIINALQALDKTYSN 65 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 66 SEMVRKILR 74 >GAV78973.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 136 Score = 77.0 bits (188), Expect = 2e-16 Identities = 38/69 (55%), Positives = 49/69 (71%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W L ITYEGT QVK SKISML ++E F M NESIS+MF +F++I+N L LGK+ Sbjct: 16 WDLLEITYEGTNQVKESKISMLVHEYELFLMHDNESISDMFTRFTTIINALKNLGKSYSN 75 Query: 183 EDQVSKVLR 209 ++ V K+LR Sbjct: 76 QELVRKILR 84 >GAV67578.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 125 Score = 76.6 bits (187), Expect = 2e-16 Identities = 36/69 (52%), Positives = 47/69 (68%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML +E F M+ NE I MF++F++I+N L AL KT Sbjct: 30 WDRLEVTYEGTNQVKEAKISMLVHDYEMFTMNKNEDIKSMFSRFTNIINALQALDKTYSN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 SEMVRKILR 98 >GAV79207.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 126 Score = 76.6 bits (187), Expect = 2e-16 Identities = 35/69 (50%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W +L +TYEGT QVK +KI ML ++E F M+ NE I MF++F++I+N L ALGKT Sbjct: 30 WDKLEVTYEGTNQVKKAKIIMLVHEYEMFTMNENEDIKSMFSRFTNIINALQALGKTYSN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 SEMVRKILR 98 >GAV64827.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 142 Score = 77.0 bits (188), Expect = 2e-16 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML ++E F M+ NE I MF++F++I+N L AL KT Sbjct: 61 WDRLEVTYEGTNQVKEAKISMLVHEYELFTMNENEDIKSMFSRFTNIINALQALDKTYSN 120 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 121 SEMVRKILR 129 >GAV71061.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 147 Score = 77.0 bits (188), Expect = 2e-16 Identities = 36/69 (52%), Positives = 47/69 (68%) Frame = +3 Query: 3 WHRLSITYEGTVQVKNSKISMLKQKFEHFRMDPNESISEMFAKFSSIVNGLNALGKTVLE 182 W RL +TYEGT QVK +KISML +E F M+ NE I MF++F++I+N L AL KT Sbjct: 30 WDRLEVTYEGTNQVKEAKISMLVHDYEMFTMNENEDIKSMFSRFTNIINALQALDKTYYN 89 Query: 183 EDQVSKVLR 209 + V K+LR Sbjct: 90 SEMVRKILR 98