BLASTX nr result
ID: Alisma22_contig00032578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00032578 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ72546.1 hypothetical protein ZOSMA_162G00690, partial [Zoster... 63 4e-10 JAT52518.1 Hepatoma-derived growth factor-related protein 2 [Ant... 68 1e-09 XP_008788631.1 PREDICTED: ENHANCER OF AG-4 protein 2-like [Phoen... 62 3e-09 XP_010454596.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isofor... 66 4e-09 XP_019107265.1 PREDICTED: ENHANCER OF AG-4 protein 2 [Beta vulga... 65 7e-09 XP_004505806.1 PREDICTED: ENHANCER OF AG-4 protein 2, partial [C... 64 2e-08 KNA22710.1 hypothetical protein SOVF_031770 [Spinacia oleracea] 64 2e-08 XP_003607250.2 enhancer OF AG-4-like protein, putative [Medicago... 64 3e-08 XP_018680871.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isofor... 64 3e-08 XP_009396154.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isofor... 64 3e-08 GAU38316.1 hypothetical protein TSUD_61770 [Trifolium subterraneum] 63 6e-08 XP_006394583.1 hypothetical protein EUTSA_v10003519mg [Eutrema s... 63 6e-08 XP_018673987.1 PREDICTED: ENHANCER OF AG-4 protein 2-like [Musa ... 63 6e-08 NP_001330849.1 Tudor/PWWP/MBT domain-containing protein [Arabido... 62 7e-08 KFK27636.1 hypothetical protein AALP_AA8G409100 [Arabis alpina] 62 8e-08 OAO92772.1 HUA2 [Arabidopsis thaliana] 62 8e-08 NP_197706.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsi... 62 8e-08 JAU94253.1 ENHANCER OF AG-4 protein 2 [Noccaea caerulescens] 62 8e-08 XP_006286897.1 hypothetical protein CARUB_v10000040mg [Capsella ... 62 8e-08 JAU35055.1 ENHANCER OF AG-4 protein 2 [Noccaea caerulescens] JAU... 62 8e-08 >KMZ72546.1 hypothetical protein ZOSMA_162G00690, partial [Zostera marina] Length = 62 Score = 63.2 bits (152), Expect = 4e-10 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVTLSGRFTMLKPCSWN 569 MPP+RKKGG +K +L LGDLVLAKVKGFPAWPAK++ KP W+ Sbjct: 1 MPPTRKKGGKGVKEKRRLNLGDLVLAKVKGFPAWPAKIS--------KPEDWS 45 >JAT52518.1 Hepatoma-derived growth factor-related protein 2 [Anthurium amnicola] Length = 1480 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 MPP+RK+GGSR + GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MPPARKRGGSRGEATGQLSLGDLVLAKVKGFPAWPAKIS 39 >XP_008788631.1 PREDICTED: ENHANCER OF AG-4 protein 2-like [Phoenix dactylifera] Length = 108 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P R+KGG+R K QL+LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRRKGGARGKANDQLKLGDLVLAKVKGFPAWPAKIS 39 >XP_010454596.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X1 [Camelina sativa] XP_010454597.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X2 [Camelina sativa] Length = 1397 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVTLSGRFTMLKPCSWN 569 M P RK+GGS+ K GQL LGDLVLAKVKGFPAWPAKV+ +P WN Sbjct: 1 MAPGRKRGGSKTKAKGQLILGDLVLAKVKGFPAWPAKVS--------RPEDWN 45 >XP_019107265.1 PREDICTED: ENHANCER OF AG-4 protein 2 [Beta vulgaris subsp. vulgaris] KMT02616.1 hypothetical protein BVRB_9g203000 [Beta vulgaris subsp. vulgaris] Length = 1428 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P+RKKG +++K A +LRLGDLVLAKVKGFPAWPAKV+ Sbjct: 1 MAPARKKGANKVKSANELRLGDLVLAKVKGFPAWPAKVS 39 >XP_004505806.1 PREDICTED: ENHANCER OF AG-4 protein 2, partial [Cicer arietinum] Length = 1418 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 MPP+R++G ++ K G LRLGDLVLAKVKGFPAWPAK++ Sbjct: 1 MPPARRRGANKAKANGHLRLGDLVLAKVKGFPAWPAKIS 39 >KNA22710.1 hypothetical protein SOVF_031770 [Spinacia oleracea] Length = 1435 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RKKG +R K A +LRLGDLVLAKVKGFPAWPAKV+ Sbjct: 1 MAPPRKKGANRTKTADELRLGDLVLAKVKGFPAWPAKVS 39 >XP_003607250.2 enhancer OF AG-4-like protein, putative [Medicago truncatula] AES89447.2 enhancer OF AG-4-like protein, putative [Medicago truncatula] Length = 1342 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 MPP+R++G ++ K G LRLGDLVLAKVKGFPAWPAK++ Sbjct: 1 MPPARRRGANKAKENGHLRLGDLVLAKVKGFPAWPAKIS 39 >XP_018680871.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 1487 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P R++GG+R+K GQL+LGD VLAKVKG+PAWPAK++ Sbjct: 1 MAPGRRRGGNRVKAMGQLKLGDFVLAKVKGYPAWPAKIS 39 >XP_009396154.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X1 [Musa acuminata subsp. malaccensis] XP_009396155.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X1 [Musa acuminata subsp. malaccensis] XP_018680870.1 PREDICTED: ENHANCER OF AG-4 protein 2-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 1495 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P R++GG+R+K GQL+LGD VLAKVKG+PAWPAK++ Sbjct: 1 MAPGRRRGGNRVKAMGQLKLGDFVLAKVKGYPAWPAKIS 39 >GAU38316.1 hypothetical protein TSUD_61770 [Trifolium subterraneum] Length = 1327 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 MPP+R++G ++ K G LRLGDLVLAKVKGFPAWPAK++ Sbjct: 1 MPPARRRGTNKAKTNGHLRLGDLVLAKVKGFPAWPAKIS 39 >XP_006394583.1 hypothetical protein EUTSA_v10003519mg [Eutrema salsugineum] ESQ31869.1 hypothetical protein EUTSA_v10003519mg [Eutrema salsugineum] Length = 1406 Score = 62.8 bits (151), Expect = 6e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAKV+ Sbjct: 1 MAPGRKRGASKAKAKGQLILGDLVLAKVKGFPAWPAKVS 39 >XP_018673987.1 PREDICTED: ENHANCER OF AG-4 protein 2-like [Musa acuminata subsp. malaccensis] Length = 1455 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVTLSGRF 542 MPP R++GG+R+K QL+ GDLVLAKVKG+PAWPAK++ F Sbjct: 1 MPPGRRRGGNRVKNLEQLKPGDLVLAKVKGYPAWPAKISRPEEF 44 >NP_001330849.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsis thaliana] ANM69148.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsis thaliana] Length = 1339 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKAKAKGQLVLGDLVLAKVKGFPAWPAKIS 39 >KFK27636.1 hypothetical protein AALP_AA8G409100 [Arabis alpina] Length = 1377 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKNKAKGQLTLGDLVLAKVKGFPAWPAKIS 39 >OAO92772.1 HUA2 [Arabidopsis thaliana] Length = 1392 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKAKAKGQLVLGDLVLAKVKGFPAWPAKIS 39 >NP_197706.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsis thaliana] NP_001330848.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsis thaliana] Q9XER9.1 RecName: Full=ENHANCER OF AG-4 protein 2; AltName: Full=Protein AERIAL ROSETTE 1 AAD31171.1 putative transcription factor [Arabidopsis thaliana] BAB11170.1 transcription factor-like protein [Arabidopsis thaliana] BAH30593.1 hypothetical protein, partial [Arabidopsis thaliana] AED93127.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsis thaliana] ANM69147.1 Tudor/PWWP/MBT domain-containing protein [Arabidopsis thaliana] Length = 1392 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKAKAKGQLVLGDLVLAKVKGFPAWPAKIS 39 >JAU94253.1 ENHANCER OF AG-4 protein 2 [Noccaea caerulescens] Length = 1394 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKAKAKGQLILGDLVLAKVKGFPAWPAKIS 39 >XP_006286897.1 hypothetical protein CARUB_v10000040mg [Capsella rubella] EOA19795.1 hypothetical protein CARUB_v10000040mg [Capsella rubella] Length = 1402 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKTKAKGQLILGDLVLAKVKGFPAWPAKIS 39 >JAU35055.1 ENHANCER OF AG-4 protein 2 [Noccaea caerulescens] JAU65738.1 ENHANCER OF AG-4 protein 2 [Noccaea caerulescens] Length = 1411 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 411 MPPSRKKGGSRLKGAGQLRLGDLVLAKVKGFPAWPAKVT 527 M P RK+G S+ K GQL LGDLVLAKVKGFPAWPAK++ Sbjct: 1 MAPGRKRGASKAKAKGQLILGDLVLAKVKGFPAWPAKIS 39