BLASTX nr result
ID: Alisma22_contig00032442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00032442 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCT65955.1 probable RPL39-60S large subunit ribosomal protein L3... 109 2e-29 XP_002848813.1 hypothetical protein MCYG_01747 [Arthroderma otae... 108 4e-29 XP_002482271.1 ribosomal protein L39e, putative [Talaromyces sti... 108 1e-28 CCX04754.1 Protein of unknown function [Pyronema omphalodes CBS ... 105 2e-28 XP_011128210.1 hypothetical protein AOL_s00215g706 [Arthrobotrys... 105 4e-28 KFY76831.1 hypothetical protein V499_03609 [Pseudogymnoascus sp.... 105 8e-28 EME43136.1 hypothetical protein DOTSEDRAFT_173805 [Dothistroma s... 103 2e-27 EHL00026.1 putative 60S ribosomal protein L39 [Glarea lozoyensis... 103 2e-27 XP_001242303.1 60S ribosomal protein L39 [Coccidioides immitis R... 103 2e-27 XP_002544670.1 predicted protein [Uncinocarpus reesii 1704] EEP7... 107 3e-27 XP_001931434.1 60S ribosomal protein L39 [Pyrenophora tritici-re... 102 5e-27 CZT11647.1 probable RPL39-60S large subunit ribosomal protein L3... 102 5e-27 XP_001559308.1 60S ribosomal protein L39 [Botrytis cinerea B05.1... 102 5e-27 XP_003003166.1 60S ribosomal protein L39 [Verticillium alfalfae ... 102 5e-27 XP_003850033.1 60S ribosomal protein L39 [Zymoseptoria tritici I... 102 5e-27 XP_003051759.1 60S ribosomal protein L39 [Nectria haematococca m... 102 7e-27 KXT01435.1 hypothetical protein AC578_9547, partial [Mycosphaere... 102 8e-27 XP_001542836.1 60S ribosomal protein L39 [Histoplasma capsulatum... 101 1e-26 XP_007675548.1 hypothetical protein BAUCODRAFT_147112 [Baudoinia... 101 1e-26 KXJ94795.1 putative 60S ribosomal protein L39 [Microdochium boll... 101 1e-26 >CCT65955.1 probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] CVL13757.1 probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium proliferatum] CZR39811.1 probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium proliferatum ET1] Length = 93 Score = 109 bits (273), Expect = 2e-29 Identities = 52/60 (86%), Positives = 54/60 (90%) Frame = +2 Query: 20 TD*SATAVKMPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 TD + AVKMPS KSFRTK KLAKAQKQN P+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 34 TDSTINAVKMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >XP_002848813.1 hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] EEQ28928.1 hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 108 bits (271), Expect = 4e-29 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = +2 Query: 29 SATAVKMPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 S+ +VKMPSQKSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 38 SSESVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >XP_002482271.1 ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] EED18279.1 ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 108 bits (269), Expect = 1e-28 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +2 Query: 38 AVKMPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 A+KMPSQKSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 56 AIKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >CCX04754.1 Protein of unknown function [Pyronema omphalodes CBS 100304] Length = 51 Score = 105 bits (263), Expect = 2e-28 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPSQKSFRTKVKLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSQKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_011128210.1 hypothetical protein AOL_s00215g706 [Arthrobotrys oligospora ATCC 24927] EGX43097.1 hypothetical protein AOL_s00215g706 [Arthrobotrys oligospora ATCC 24927] EWC45625.1 60S ribosomal protein L39 [Drechslerella stenobrocha 248] Length = 51 Score = 105 bits (261), Expect = 4e-28 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPSQKSFRTKVKLAKA+KQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSQKSFRTKVKLAKAKKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >KFY76831.1 hypothetical protein V499_03609 [Pseudogymnoascus sp. VKM F-103] Length = 89 Score = 105 bits (262), Expect = 8e-28 Identities = 52/66 (78%), Positives = 55/66 (83%) Frame = +2 Query: 2 HHQPVSTD*SATAVKMPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWR 181 + QP +T + KMPS KSFRTKVKLAKAQK N PIPQWIRLRTGNTIRYNAKRRHWR Sbjct: 27 YRQPPTT---RQSFKMPSHKSFRTKVKLAKAQKSNRPIPQWIRLRTGNTIRYNAKRRHWR 83 Query: 182 KTRIGI 199 KTRIGI Sbjct: 84 KTRIGI 89 >EME43136.1 hypothetical protein DOTSEDRAFT_173805 [Dothistroma septosporum NZE10] Length = 51 Score = 103 bits (257), Expect = 2e-27 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS K+FRTKVKLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKTFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >EHL00026.1 putative 60S ribosomal protein L39 [Glarea lozoyensis 74030] Length = 51 Score = 103 bits (257), Expect = 2e-27 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS KSFRTKVKLA+AQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKVKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >XP_001242303.1 60S ribosomal protein L39 [Coccidioides immitis RS] XP_003069553.1 60S ribosomal protein L39 [Coccidioides posadasii C735 delta SOWgp] XP_007686227.1 hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] XP_007697307.1 hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] XP_007707561.1 hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] XP_014559883.1 hypothetical protein COCVIDRAFT_23909 [Bipolaris victoriae FI3] EER27408.1 60S ribosomal protein L39, putative [Coccidioides posadasii C735 delta SOWgp] EFW22985.1 hypothetical protein CPSG_00884 [Coccidioides posadasii str. Silveira] EMD67723.1 hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] EMD91969.1 hypothetical protein COCHEDRAFT_1223922 [Bipolaris maydis C5] EUC38088.1 hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] EUC47244.1 hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] EUN30389.1 hypothetical protein COCVIDRAFT_23909 [Bipolaris victoriae FI3] KFX44403.1 60S ribosomal protein L39 [Talaromyces marneffei PM1] EAS30720.3 60S ribosomal protein L39 [Coccidioides immitis RS] KMM67224.1 hypothetical protein CPAG_03559 [Coccidioides posadasii RMSCC 3488] KMP03296.1 hypothetical protein CIRG_02988 [Coccidioides immitis RMSCC 2394] KMU80282.1 hypothetical protein CISG_08388 [Coccidioides immitis RMSCC 3703] KMU84880.1 hypothetical protein CIHG_02663 [Coccidioides immitis H538.4] OAL02628.1 putative 60S ribosomal protein L39 [Stagonospora sp. SRC1lsM3a] OJI98962.1 hypothetical protein ASPVEDRAFT_38429 [Aspergillus versicolor CBS 583.65] Length = 51 Score = 103 bits (257), Expect = 2e-27 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPSQKSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_002544670.1 predicted protein [Uncinocarpus reesii 1704] EEP79341.1 predicted protein [Uncinocarpus reesii 1704] Length = 183 Score = 107 bits (266), Expect = 3e-27 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +2 Query: 41 VKMPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 VKMPSQKSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 131 VKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 183 >XP_001931434.1 60S ribosomal protein L39 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003305050.1 60S ribosomal protein L39 [Pyrenophora teres f. teres 0-1] XP_018385117.1 ribosomal protein L39e [Alternaria alternata] EDU40539.1 60S ribosomal protein L39 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ86842.1 hypothetical protein PTT_17793 [Pyrenophora teres f. teres 0-1] OAG19696.1 ribosomal protein L39e [Alternaria alternata] Length = 51 Score = 102 bits (254), Expect = 5e-27 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPSQKSFRTK KLA+AQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >CZT11647.1 probable RPL39-60S large subunit ribosomal protein L39.e [Rhynchosporium agropyri] Length = 51 Score = 102 bits (254), Expect = 5e-27 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS K+FRTKVKLA+AQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKTFRTKVKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >XP_001559308.1 60S ribosomal protein L39 [Botrytis cinerea B05.10] XP_001598455.1 60S ribosomal protein L39 [Sclerotinia sclerotiorum 1980 UF-70] EDN91141.1 60S ribosomal protein L39 [Sclerotinia sclerotiorum 1980 UF-70] CCD44013.1 similar to 60S ribosomal protein L39 [Botrytis cinerea T4] APA07852.1 hypothetical protein sscle_03g026220 [Sclerotinia sclerotiorum 1980 UF-70] Length = 51 Score = 102 bits (254), Expect = 5e-27 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPSQKSFRTK KLA+AQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIG+ Sbjct: 1 MPSQKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >XP_003003166.1 60S ribosomal protein L39 [Verticillium alfalfae VaMs.102] XP_009653481.1 60S ribosomal protein L39 [Verticillium dahliae VdLs.17] EEY20618.1 60S ribosomal protein L39 [Verticillium alfalfae VaMs.102] EGY14625.1 60S ribosomal protein L39 [Verticillium dahliae VdLs.17] CRK30714.1 hypothetical protein BN1708_015843 [Verticillium longisporum] Length = 51 Score = 102 bits (254), Expect = 5e-27 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS KSFRTKVKLAKAQKQN PIPQW+RLRTGNTIRYNAKRRHWRKT++GI Sbjct: 1 MPSHKSFRTKVKLAKAQKQNRPIPQWVRLRTGNTIRYNAKRRHWRKTKLGI 51 >XP_003850033.1 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] XP_007781320.1 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] XP_018036096.1 ribosomal protein L39e [Paraphaeosphaeria sporulosa] EGP85009.1 hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] EON66003.1 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] KIN06246.1 hypothetical protein OIDMADRAFT_38580 [Oidiodendron maius Zn] GAM86723.1 hypothetical protein ANO11243_047420 [fungal sp. No.11243] KJX99510.1 60S ribosomal protein L39 [Zymoseptoria brevis] KXL50793.1 hypothetical protein FE78DRAFT_158233 [Acidomyces richmondensis] KYG48472.1 hypothetical protein M433DRAFT_102650 [Acidomyces richmondensis BFW] OAG05731.1 ribosomal protein L39e [Paraphaeosphaeria sporulosa] Length = 51 Score = 102 bits (254), Expect = 5e-27 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS KSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >XP_003051759.1 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] XP_009263131.1 hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] XP_011326588.1 hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] XP_018754742.1 60S ribosomal protein L39 [Fusarium verticillioides 7600] EEU46046.1 predicted protein [Nectria haematococca mpVI 77-13-4] EGU71968.1 hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] EKJ67928.1 hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] ESU13081.1 hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] EWG48551.1 60S ribosomal protein L39 [Fusarium verticillioides 7600] EWY98599.1 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] EWZ44675.1 60S ribosomal protein L39 [Fusarium oxysporum Fo47] EWZ98448.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] EXA49958.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] EXK42041.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] EXL00613.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] EXL62002.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL86129.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXL95148.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM36611.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] EYB23707.1 hypothetical protein FG05_06921 [Fusarium graminearum] KLO90055.1 putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] KLP09859.1 putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] KLP19369.1 putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] SCB65143.1 unnamed protein product [Fusarium graminearum] Length = 51 Score = 102 bits (253), Expect = 7e-27 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS KSFRTK KLAKAQKQN P+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >KXT01435.1 hypothetical protein AC578_9547, partial [Mycosphaerella eumusae] Length = 81 Score = 102 bits (255), Expect = 8e-27 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = +2 Query: 41 VKMPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 V MPS K+FRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 29 VNMPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 81 >XP_001542836.1 60S ribosomal protein L39 [Histoplasma capsulatum NAm1] XP_003230906.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] XP_003712476.1 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] XP_007599880.1 hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] XP_008022948.1 hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] XP_009219929.1 60S ribosomal protein L39 [Gaeumannomyces tritici R3-111a-1] EDN06404.1 ribosomal protein L39 [Histoplasma capsulatum NAm1] CBF86564.1 TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] EHA52669.1 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] EJT78784.1 60S ribosomal protein L39 [Gaeumannomyces tritici R3-111a-1] ELQ44608.1 hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] ELQ67556.1 hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] EOA89386.1 hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] ERS99941.1 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] EXF76478.1 hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] EZF28033.1 60S ribosomal protein L39 [Trichophyton rubrum MR850] EZF47097.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] EZF57748.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] EZF68319.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] EZF79023.1 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] EZF89637.1 60S ribosomal protein L39 [Trichophyton rubrum MR1448] EZG00476.1 60S ribosomal protein L39 [Trichophyton rubrum MR1459] EZG05683.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] EZG22078.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] KDB38828.1 60S ribosomal protein L39 [Trichophyton rubrum D6] KLU81216.1 60S ribosomal protein L39 [Magnaporthiopsis poae ATCC 64411] CEL09978.1 Putative 60S ribosomal protein L39 [Aspergillus calidoustus] OHE95651.1 hypothetical protein CORC01_09083 [Colletotrichum orchidophilum] GAW11006.1 hypothetical protein ANO14919_003450 [fungal sp. No.14919] Length = 51 Score = 101 bits (252), Expect = 1e-26 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS KSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_007675548.1 hypothetical protein BAUCODRAFT_147112 [Baudoinia panamericana UAMH 10762] EMC96913.1 hypothetical protein BAUCODRAFT_147112 [Baudoinia panamericana UAMH 10762] Length = 51 Score = 101 bits (252), Expect = 1e-26 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPS KSFRTK KLAKAQKQN PIPQWIRLRTGNTIRYNAKRRHWRKTRIG+ Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >KXJ94795.1 putative 60S ribosomal protein L39 [Microdochium bolleyi] Length = 51 Score = 101 bits (251), Expect = 1e-26 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +2 Query: 47 MPSQKSFRTKVKLAKAQKQNSPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 199 MPSQK+FRTK KLAKAQKQN PIPQWIRLRTGNTIRYN+KRRHWRKTR+GI Sbjct: 1 MPSQKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNSKRRHWRKTRLGI 51