BLASTX nr result
ID: Alisma22_contig00031982
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00031982 (482 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020084915.1 uncharacterized protein LOC109707794 [Ananas como... 58 9e-07 >XP_020084915.1 uncharacterized protein LOC109707794 [Ananas comosus] Length = 873 Score = 57.8 bits (138), Expect = 9e-07 Identities = 42/141 (29%), Positives = 74/141 (52%), Gaps = 2/141 (1%) Frame = -3 Query: 471 HLVLPLSLTRLEIKDWESRIDCFRICIVG*KQRLPL*EAHGN-FSNYNIVQDTVHIYLMA 295 +L LPL ++ L KDW I+ + I G K +L +HG N V + ++ A Sbjct: 510 YLGLPLHISPLRKKDWAPIINRIEMRIEGWKAKLL---SHGGRVILVNSVLSNLPLFYFA 566 Query: 294 MFKLHIYVLHRLDAIEK*FFWKG-ETCQRYSHLIAWKRVCLGKKFGRASHALGRFELCSL 118 +FK +VL+R++A+ + FFWKG S L++WK +C K+ G LG ++ ++ Sbjct: 567 IFKASQWVLNRIEALRRAFFWKGCSNISGGSCLVSWKIICKSKREG----GLGIKDMEAM 622 Query: 117 TKCICPIVNWIFKQYSLRRVL 55 K + + W ++ ++ R +L Sbjct: 623 NKAL--LTKWWWRFFNERHLL 641