BLASTX nr result
ID: Alisma22_contig00031669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00031669 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMS52624.1 hypothetical protein TRIUR3_28191 [Triticum urartu] 58 2e-08 AFG67451.1 hypothetical protein CL196Contig1_05, partial [Pinus ... 56 2e-08 CDP14493.1 unnamed protein product [Coffea canephora] 59 3e-08 GAV88746.1 Phi_1 domain-containing protein [Cephalotus follicula... 59 3e-08 XP_008372848.1 PREDICTED: protein EXORDIUM-like 5 [Malus domestica] 59 3e-08 XP_010266210.1 PREDICTED: protein EXORDIUM-like 5 [Nelumbo nucif... 59 3e-08 XP_009373409.1 PREDICTED: protein EXORDIUM-like 5 [Pyrus x brets... 59 3e-08 XP_002467577.1 hypothetical protein SORBIDRAFT_01g030360 [Sorghu... 59 4e-08 XP_008658055.1 PREDICTED: uncharacterized protein LOC103637609 [... 59 4e-08 XP_007201397.1 hypothetical protein PRUPE_ppa007966mg [Prunus pe... 59 4e-08 OIW13102.1 hypothetical protein TanjilG_08135 [Lupinus angustifo... 59 5e-08 KQK90134.1 hypothetical protein SETIT_039995mg [Setaria italica] 59 6e-08 XP_004983792.1 PREDICTED: protein EXORDIUM-like 5 [Setaria italica] 59 6e-08 OEL23124.1 Protein EXORDIUM-like 5 [Dichanthelium oligosanthes] 59 6e-08 XP_003555525.1 PREDICTED: protein EXORDIUM-like 5 [Glycine max] ... 59 6e-08 KYP74630.1 hypothetical protein KK1_007317 [Cajanus cajan] 59 6e-08 XP_003536203.2 PREDICTED: protein EXORDIUM-like 5 [Glycine max] ... 59 6e-08 XP_019441129.1 PREDICTED: protein EXORDIUM-like 5 [Lupinus angus... 59 6e-08 XP_008448188.2 PREDICTED: protein EXORDIUM-like 5 [Cucumis melo] 58 7e-08 EPS71473.1 hypothetical protein M569_03279, partial [Genlisea au... 58 7e-08 >EMS52624.1 hypothetical protein TRIUR3_28191 [Triticum urartu] Length = 158 Score = 58.2 bits (139), Expect = 2e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V+ +GHELAELA + LVN WYAG+ PTA TEIADLC Sbjct: 67 VIVLGHELAELATNPLVNAWYAGDTPTAPTEIADLC 102 >AFG67451.1 hypothetical protein CL196Contig1_05, partial [Pinus taeda] AFG67452.1 hypothetical protein CL196Contig1_05, partial [Pinus taeda] AFG67453.1 hypothetical protein CL196Contig1_05, partial [Pinus taeda] AFG67454.1 hypothetical protein CL196Contig1_05, partial [Pinus taeda] Length = 67 Score = 55.8 bits (133), Expect = 2e-08 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + + HELAELA + LVN WYAG+DP+A TEIADLC Sbjct: 27 ISVIAHELAELASNPLVNAWYAGQDPSAPTEIADLC 62 >CDP14493.1 unnamed protein product [Coffea canephora] Length = 283 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAELA + LVN WYAGEDPTA TEI DLC Sbjct: 193 ISVIGHELAELASNPLVNAWYAGEDPTAPTEIGDLC 228 >GAV88746.1 Phi_1 domain-containing protein [Cephalotus follicularis] Length = 349 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAELA + LVN WYAGEDPTA TEI DLC Sbjct: 259 ISVIGHELAELATNPLVNAWYAGEDPTAPTEIGDLC 294 >XP_008372848.1 PREDICTED: protein EXORDIUM-like 5 [Malus domestica] Length = 349 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAELA + LVN WYAGEDPTA TEI DLC Sbjct: 259 ISVIGHELAELASNPLVNAWYAGEDPTAPTEIGDLC 294 >XP_010266210.1 PREDICTED: protein EXORDIUM-like 5 [Nelumbo nucifera] Length = 350 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAELA + LVN WYAGEDPTA TEI DLC Sbjct: 260 ISVIGHELAELASNPLVNAWYAGEDPTAPTEIGDLC 295 >XP_009373409.1 PREDICTED: protein EXORDIUM-like 5 [Pyrus x bretschneideri] Length = 350 Score = 59.3 bits (142), Expect = 3e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAELA + LVN WYAGEDPTA TEI DLC Sbjct: 260 ISVIGHELAELASNPLVNAWYAGEDPTAPTEIGDLC 295 >XP_002467577.1 hypothetical protein SORBIDRAFT_01g030360 [Sorghum bicolor] EER94575.1 hypothetical protein SORBI_001G311800 [Sorghum bicolor] Length = 330 Score = 58.9 bits (141), Expect = 4e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V + HELAELA + LVN WYAGEDPTA TEIADLC Sbjct: 240 VSVIAHELAELATNPLVNAWYAGEDPTAPTEIADLC 275 >XP_008658055.1 PREDICTED: uncharacterized protein LOC103637609 [Zea mays] ONL99588.1 Protein EXORDIUM-like 5 [Zea mays] Length = 335 Score = 58.9 bits (141), Expect = 4e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V + HELAELA + LVN WYAGEDPTA TEIADLC Sbjct: 245 VSVIAHELAELATNPLVNAWYAGEDPTAPTEIADLC 280 >XP_007201397.1 hypothetical protein PRUPE_ppa007966mg [Prunus persica] ONH92520.1 hypothetical protein PRUPE_8G179300 [Prunus persica] Length = 350 Score = 58.9 bits (141), Expect = 4e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAELA + L+N WYAGEDPTA TEI DLC Sbjct: 260 ISVIGHELAELASNPLINAWYAGEDPTAPTEIGDLC 295 >OIW13102.1 hypothetical protein TanjilG_08135 [Lupinus angustifolius] Length = 283 Score = 58.5 bits (140), Expect = 5e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V +GHELAEL+ + LVN WYAGEDPTA TEI DLC Sbjct: 193 VSVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDLC 228 >KQK90134.1 hypothetical protein SETIT_039995mg [Setaria italica] Length = 328 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V + HELAELA + L+N WYAGEDPTA TEIADLC Sbjct: 238 VSVIAHELAELATNPLINAWYAGEDPTAPTEIADLC 273 >XP_004983792.1 PREDICTED: protein EXORDIUM-like 5 [Setaria italica] Length = 333 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V + HELAELA + L+N WYAGEDPTA TEIADLC Sbjct: 243 VSVIAHELAELATNPLINAWYAGEDPTAPTEIADLC 278 >OEL23124.1 Protein EXORDIUM-like 5 [Dichanthelium oligosanthes] Length = 334 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V + HELAELA + L+N WYAGEDPTA TEIADLC Sbjct: 244 VSVIAHELAELATNPLINAWYAGEDPTAPTEIADLC 279 >XP_003555525.1 PREDICTED: protein EXORDIUM-like 5 [Glycine max] KRG92438.1 hypothetical protein GLYMA_20G211000 [Glycine max] Length = 342 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V +GHELAEL+ + LVN WYAGEDPTA TEI DLC Sbjct: 252 VSVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDLC 287 >KYP74630.1 hypothetical protein KK1_007317 [Cajanus cajan] Length = 348 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V +GHELAEL+ + LVN WYAGEDPTA TEI DLC Sbjct: 258 VSVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDLC 293 >XP_003536203.2 PREDICTED: protein EXORDIUM-like 5 [Glycine max] KRH34361.1 hypothetical protein GLYMA_10G179200 [Glycine max] Length = 384 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V +GHELAEL+ + LVN WYAGEDPTA TEI DLC Sbjct: 294 VSVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDLC 329 >XP_019441129.1 PREDICTED: protein EXORDIUM-like 5 [Lupinus angustifolius] Length = 404 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 V +GHELAEL+ + LVN WYAGEDPTA TEI DLC Sbjct: 314 VSVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDLC 349 >XP_008448188.2 PREDICTED: protein EXORDIUM-like 5 [Cucumis melo] Length = 285 Score = 58.2 bits (139), Expect = 7e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAE+A + LVN WYAGEDPTA TEI DLC Sbjct: 195 ISVIGHELAEVASNPLVNAWYAGEDPTAPTEIGDLC 230 >EPS71473.1 hypothetical protein M569_03279, partial [Genlisea aurea] Length = 300 Score = 58.2 bits (139), Expect = 7e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 192 VLAVGHELAELAMDALVNVWYAGEDPTALTEIADLC 299 + +GHELAEL+ + LVN WYAGEDPTA TEI DLC Sbjct: 210 ISVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDLC 245