BLASTX nr result
ID: Alisma22_contig00031446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00031446 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19211.1 hypothetical protein TSUD_198940, partial [Trifolium ... 62 1e-09 GAU51466.1 hypothetical protein TSUD_85510 [Trifolium subterraneum] 54 2e-07 OIT19063.1 hypothetical protein A4A49_42526 [Nicotiana attenuata] 51 9e-06 >GAU19211.1 hypothetical protein TSUD_198940, partial [Trifolium subterraneum] Length = 202 Score = 62.0 bits (149), Expect = 1e-09 Identities = 43/100 (43%), Positives = 51/100 (51%), Gaps = 9/100 (9%) Frame = -3 Query: 283 APDCEGPLCPWSS----LRKAWPPVAEFPSARKV*VLAFSWSQRSGLFVRLLREEEKAKR 116 APDC+ PL + A+P + FPSAR W REE+K R Sbjct: 43 APDCDSPLDTLLVGALLVVAAFPSLEPFPSARSP--TPGGW-----------REEDKKTR 89 Query: 115 SLGF-----ASDSKGCPLSAGCWSSLLRGSRIPSSSFSRG 11 S+ AS SKGCPLSAGCWSSLLRGSRI + +G Sbjct: 90 SVLLVSQLVASKSKGCPLSAGCWSSLLRGSRIQQPNLKKG 129 >GAU51466.1 hypothetical protein TSUD_85510 [Trifolium subterraneum] Length = 115 Score = 54.3 bits (129), Expect = 2e-07 Identities = 35/72 (48%), Positives = 40/72 (55%), Gaps = 5/72 (6%) Frame = -3 Query: 235 AWPPVAEFPSARKV*VLAFSWSQRSGLFVRLLREEEKAKRSLGF-----ASDSKGCPLSA 71 A+P + FPSAR W REE+K RS+ AS SKGCPLSA Sbjct: 29 AFPSLEPFPSARSP--TPGGW-----------REEDKKTRSVLLVSQLVASKSKGCPLSA 75 Query: 70 GCWSSLLRGSRI 35 GCWSSLLRGSR+ Sbjct: 76 GCWSSLLRGSRL 87 >OIT19063.1 hypothetical protein A4A49_42526 [Nicotiana attenuata] Length = 150 Score = 50.8 bits (120), Expect = 9e-06 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = -3 Query: 157 LFVRLL-REEEKAKRSLGFASD---SKGCPLSAGCWSSLLRGSRIPSSSFSRG 11 LFV LL REE+K RS+ S SK CPLSAG WSSLLRGSRI + +G Sbjct: 88 LFVLLLGREEDKKTRSVLLLSQPVVSKDCPLSAGSWSSLLRGSRIQQPNLYKG 140