BLASTX nr result
ID: Alisma22_contig00031306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00031306 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN06550.1 hypothetical protein AMTR_s00058p00117500 [Amborella ... 56 4e-07 XP_006844876.2 PREDICTED: uncharacterized protein LOC18434750 [A... 56 2e-06 >ERN06550.1 hypothetical protein AMTR_s00058p00117500 [Amborella trichopoda] Length = 163 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/54 (42%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -1 Query: 391 KKHKMNMSKLS-FKKSFAGKGFVWCEECNIPCSNLYILAQHRMGKKHLARIEML 233 KKHK + ++ K+ G G +WC++C +PCSN + QH GK+H+ARI+ L Sbjct: 11 KKHKEKLEEMKELKRRGMGAGALWCKKCGVPCSNKVAMEQHLSGKRHIARIQEL 64 >XP_006844876.2 PREDICTED: uncharacterized protein LOC18434750 [Amborella trichopoda] Length = 388 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/54 (42%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -1 Query: 391 KKHKMNMSKLS-FKKSFAGKGFVWCEECNIPCSNLYILAQHRMGKKHLARIEML 233 KKHK + ++ K+ G G +WC++C +PCSN + QH GK+H+ARI+ L Sbjct: 236 KKHKEKLEEMKELKRRGMGAGALWCKKCGVPCSNKVAMEQHLSGKRHIARIQEL 289