BLASTX nr result
ID: Alisma22_contig00031255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00031255 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47057.1 hypothetical protein TSUD_181700 [Trifolium subterran... 58 5e-09 KDO63446.1 hypothetical protein CISIN_1g029558mg [Citrus sinensis] 59 2e-08 OIT06441.1 monothiol glutaredoxin-s7, chloroplastic [Nicotiana a... 58 4e-08 XP_004981029.1 PREDICTED: monothiol glutaredoxin-S7, chloroplast... 58 4e-08 EMT16112.1 Monothiol glutaredoxin-S7, chloroplastic [Aegilops ta... 58 5e-08 OAY52590.1 hypothetical protein MANES_04G095400 [Manihot esculenta] 58 5e-08 ABR26131.1 osgrx_s14 - glutaredoxin subgroup ii, partial [Oryza ... 56 6e-08 XP_008646902.1 PREDICTED: monothiol glutaredoxin-S7, chloroplast... 58 7e-08 2LKU_A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 56 1e-07 XP_006652025.1 PREDICTED: monothiol glutaredoxin-S7, chloroplast... 56 1e-07 ERN06436.1 hypothetical protein AMTR_s00016p00257320 [Amborella ... 57 1e-07 OMO90784.1 Glutaredoxin [Corchorus capsularis] 57 1e-07 XP_013449360.1 Grx4 family monothiol glutaredoxin [Medicago trun... 56 2e-07 XP_019052478.1 PREDICTED: monothiol glutaredoxin-S14, chloroplas... 55 2e-07 KVI09225.1 Glutaredoxin [Cynara cardunculus var. scolymus] 57 2e-07 EMS55349.1 Monothiol glutaredoxin-S7, chloroplastic [Triticum ur... 55 2e-07 XP_001776885.1 predicted protein [Physcomitrella patens] EDQ5828... 55 3e-07 EEF49285.1 glutaredoxin, grx, putative [Ricinus communis] 56 3e-07 XP_015630443.1 PREDICTED: monothiol glutaredoxin-S7, chloroplast... 56 3e-07 EEC76549.1 hypothetical protein OsI_14350 [Oryza sativa Indica G... 56 3e-07 >GAU47057.1 hypothetical protein TSUD_181700 [Trifolium subterraneum] Length = 72 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 SSWPTFPQLYIDGEFFGGCDITVG Sbjct: 46 SSWPTFPQLYIDGEFFGGCDITVG 69 >KDO63446.1 hypothetical protein CISIN_1g029558mg [Citrus sinensis] Length = 191 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVGLSMD 86 SSWPTFPQLYI+GEFFGGCDITVG MD Sbjct: 139 SSWPTFPQLYIEGEFFGGCDITVGKLMD 166 >OIT06441.1 monothiol glutaredoxin-s7, chloroplastic [Nicotiana attenuata] Length = 167 Score = 58.2 bits (139), Expect = 4e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 SSWPTFPQLYIDGEFFGGCDITVG Sbjct: 140 SSWPTFPQLYIDGEFFGGCDITVG 163 >XP_004981029.1 PREDICTED: monothiol glutaredoxin-S7, chloroplastic isoform X2 [Setaria italica] KQK86150.1 hypothetical protein SETIT_037775mg [Setaria italica] Length = 171 Score = 58.2 bits (139), Expect = 4e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 SSWPTFPQLYIDGEFFGGCDITVG Sbjct: 131 SSWPTFPQLYIDGEFFGGCDITVG 154 >EMT16112.1 Monothiol glutaredoxin-S7, chloroplastic [Aegilops tauschii] Length = 160 Score = 57.8 bits (138), Expect = 5e-08 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVGL 77 SSWPTFPQLYIDGEFFGGCDIT+G+ Sbjct: 123 SSWPTFPQLYIDGEFFGGCDITLGM 147 >OAY52590.1 hypothetical protein MANES_04G095400 [Manihot esculenta] Length = 190 Score = 58.2 bits (139), Expect = 5e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 SSWPTFPQLYIDGEFFGGCDITVG Sbjct: 137 SSWPTFPQLYIDGEFFGGCDITVG 160 >ABR26131.1 osgrx_s14 - glutaredoxin subgroup ii, partial [Oryza sativa Indica Group] Length = 89 Score = 55.8 bits (133), Expect = 6e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 49 SSWPTFPQLYIDGEFFGGCDITV 71 >XP_008646902.1 PREDICTED: monothiol glutaredoxin-S7, chloroplastic-like [Zea mays] Length = 204 Score = 58.2 bits (139), Expect = 7e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 SSWPTFPQLYIDGEFFGGCDITVG Sbjct: 132 SSWPTFPQLYIDGEFFGGCDITVG 155 >2LKU_A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 Score = 55.8 bits (133), Expect = 1e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 69 SSWPTFPQLYIDGEFFGGCDITV 91 >XP_006652025.1 PREDICTED: monothiol glutaredoxin-S7, chloroplastic, partial [Oryza brachyantha] Length = 115 Score = 55.8 bits (133), Expect = 1e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 75 SSWPTFPQLYIDGEFFGGCDITV 97 >ERN06436.1 hypothetical protein AMTR_s00016p00257320 [Amborella trichopoda] Length = 172 Score = 57.0 bits (136), Expect = 1e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 S+WPTFPQLYIDGEFFGGCDITVG Sbjct: 138 SNWPTFPQLYIDGEFFGGCDITVG 161 >OMO90784.1 Glutaredoxin [Corchorus capsularis] Length = 162 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 SSWPTFPQLYI+GEFFGGCDITVG Sbjct: 139 SSWPTFPQLYIEGEFFGGCDITVG 162 >XP_013449360.1 Grx4 family monothiol glutaredoxin [Medicago truncatula] KEH23388.1 Grx4 family monothiol glutaredoxin [Medicago truncatula] Length = 131 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 91 SSWPTFPQLYIDGEFFGGCDITV 113 >XP_019052478.1 PREDICTED: monothiol glutaredoxin-S14, chloroplastic [Nelumbo nucifera] Length = 86 Score = 54.7 bits (130), Expect = 2e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 S+WPTFPQLYIDGEFFGGCDITV Sbjct: 46 SNWPTFPQLYIDGEFFGGCDITV 68 >KVI09225.1 Glutaredoxin [Cynara cardunculus var. scolymus] Length = 202 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVGLSMD*CQLDVS 107 S WPTFPQLYIDGEFFGGCDI VG + C ++S Sbjct: 137 SQWPTFPQLYIDGEFFGGCDIAVGKFIPSCYQNIS 171 >EMS55349.1 Monothiol glutaredoxin-S7, chloroplastic [Triticum urartu] Length = 103 Score = 54.7 bits (130), Expect = 2e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDIT+ Sbjct: 63 SSWPTFPQLYIDGEFFGGCDITL 85 >XP_001776885.1 predicted protein [Physcomitrella patens] EDQ58288.1 predicted protein, partial [Physcomitrella patens] Length = 106 Score = 54.7 bits (130), Expect = 3e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITVG 74 S WPTFPQLYIDGEFFGGCDIT G Sbjct: 67 SDWPTFPQLYIDGEFFGGCDITYG 90 >EEF49285.1 glutaredoxin, grx, putative [Ricinus communis] Length = 160 Score = 55.8 bits (133), Expect = 3e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 129 SSWPTFPQLYIDGEFFGGCDITV 151 >XP_015630443.1 PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Oryza sativa Japonica Group] Q851Y7.1 RecName: Full=Monothiol glutaredoxin-S7, chloroplastic; Flags: Precursor AAO20065.1 hypothetical protein [Oryza sativa Japonica Group] ABF99928.1 expressed protein [Oryza sativa Japonica Group] BAF13827.1 Os03g0851200 [Oryza sativa Japonica Group] BAG86988.1 unnamed protein product [Oryza sativa Japonica Group] EEE60311.1 hypothetical protein OsJ_13389 [Oryza sativa Japonica Group] BAS87384.1 Os03g0851200 [Oryza sativa Japonica Group] Length = 168 Score = 55.8 bits (133), Expect = 3e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 128 SSWPTFPQLYIDGEFFGGCDITV 150 >EEC76549.1 hypothetical protein OsI_14350 [Oryza sativa Indica Group] Length = 168 Score = 55.8 bits (133), Expect = 3e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 SSWPTFPQLYIDGEFFGGCDITV 71 SSWPTFPQLYIDGEFFGGCDITV Sbjct: 128 SSWPTFPQLYIDGEFFGGCDITV 150